diff --git a/.github/workflows/build-docker-images.yml b/.github/workflows/build-docker-images.yml index fcb7722..e16dc46 100644 --- a/.github/workflows/build-docker-images.yml +++ b/.github/workflows/build-docker-images.yml @@ -16,12 +16,3 @@ jobs: - uses: actions/checkout@v3 - name: Build the full Docker image run: docker build . --file Dockerfile --tag streamlitapp:latest - - build-simple-app: - - runs-on: ubuntu-latest - - steps: - - uses: actions/checkout@v3 - - name: Build the Docker image (pyOpenMS only) - run: docker build . --file Dockerfile_simple --tag streamlitapp-simple:latest \ No newline at end of file diff --git a/content/digest.py b/content/digest.py deleted file mode 100644 index 8cd70f9..0000000 --- a/content/digest.py +++ /dev/null @@ -1,321 +0,0 @@ -""" -In Silico Protein Digest Page - -This module provides functionality for performing in silico protein digestion -using pyOpenMS. Users can input protein sequences in FASTA format and get -peptide lists with mass calculations. -""" - -import streamlit as st -import sys -from pathlib import Path - -# Add utils to path -sys.path.append(str(Path(__file__).parent.parent)) - -from utils.fasta import validate_fasta_input -from utils.digest import perform_digest, get_digest_statistics, get_available_enzymes, filter_peptides_by_length, calculate_protein_coverage, generate_coverage_html - -# Default values -DEFAULT_ENZYME = "Trypsin" -DEFAULT_MISSED_CLEAVAGES = 0 # Changed from 2 to 0 -DEFAULT_MAX_CHARGES = 5 -DEFAULT_MIN_PEPTIDE_LENGTH = 6 -DEFAULT_MAX_PEPTIDE_LENGTH = 50 - - -def main(): - """Main function for the digest page.""" - st.title("✂️ In Silico Protein Digest") - - st.markdown(""" - **Simulate enzymatic protein digestion computationally** to predict peptides for mass spectrometry analysis. - - This tool uses pyOpenMS to perform theoretical protein digestion with various proteases, helping you: - - **Plan MS experiments** by predicting which peptides will be generated - - **Optimize digestion conditions** by testing different enzymes and parameters - - **Analyze protein coverage** and identify potential issues before experimental work - - **Generate theoretical peptide lists** with accurate mass-to-charge ratios - """) - - with st.expander("📚 **How In Silico Digestion Works**"): - st.markdown(""" - **Enzymatic Cleavage Simulation:** - - Enzymes cut proteins at specific amino acid sequences (cleavage sites) - - **Trypsin** cuts after K (lysine) and R (arginine), except when followed by P (proline) - - **Pepsin** cuts preferentially at F, L, W, Y amino acids under acidic conditions - - **Chymotrypsin** cuts after F, W, Y, L amino acids - - **Missed Cleavages:** - - Real digestion is not 100% efficient - some cleavage sites are missed - - Allows prediction of longer peptides that contain uncleaved sites - - Important for comprehensive coverage analysis - - **Applications:** - - **Bottom-up proteomics** experiment planning - - **Peptide mapping** for protein characterization - - **Method development** for LC-MS/MS workflows - - **Quality control** for digestion efficiency assessment - """) - - # Input form section - with st.form("digest_form"): - st.subheader("Input Parameters") - - # FASTA input - default_sequence = """>sp|Q9UPY3|DICER_HUMAN Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1 PE=1 SV=3 -MKSPALQPLSMAGLQLMTPASSPMGPFFGLPWQQEAIHDNIYTPRKYQVELLEAALDHNT -IVCLNTGSGKTFIAVLLTKELSYQIRGDFSRNGKRTVFLVNSANQVAQQVSAVRTHSDLK -VGEYSNLEVNASWTKERWNQEFTKHQVLIMTCYVALNVLKNGYLSLSDINLLVFDECHLA -ILDHPYREIMKLCENCPSCPRILGLTASILNGKCDPEELEEKIQKLEKILKSNAETATDL -VVLDRYTSQPCEIVVDCGPFTDRSGLYERLLMELEEALNFINDCNISVHSKERDSTLISK -QILSDCRAVLVVLGPWCADKVAGMMVRELQKYIKHEQEELHRKFLLFTDTFLRKIHALCE -EHFSPASLDLKFVTPKVIKLLEILRKYKPYERQQFESVEWYNNRNQDNYVSWSDSEDDDE -DEEIEEKEKPETNFPSPFTNILCGIIFVERRYTAVVLNRLIKEAGKQDPELAYISSNFIT -GHGIGKNQPRNKQMEAEFRKQEEVLRKFRAHETNLLIATSIVEEGVDIPKCNLVVRFDLP -TEYRSYVQSKGRARAPISNYIMLADTDKIKSFEEDLKTYKAIEKILRNKCSKSVDTGETD -IDPVMDDDDVFPPYVLRPDDGGPRVTINTAIGHINRYCARLPSDPFTHLAPKCRTRELPD -GTFYSTLYLPINSPLRASIVGPPMSCVRLAERVVALICCEKLHKIGELDDHLMPVGKETV -KYEEELDLHDEEETSVPGRPGSTKRRQCYPKAIPECLRDSYPRPDQPCYLYVIGMVLTTP -LPDELNFRRRKLYPPEDTTRCFGILTAKPIPQIPHFPVYTRSGEVTISIELKKSGFMLSL -QMLELITRLHQYIFSHILRLEKPALEFKPTDADSAYCVLPLNVVNDSSTLDIDFKFMEDI -EKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKF -PSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKR -KAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLHCLLTAEELRAQTASDAGV -GVRSLPADFRYPNLDFGWKKSIDSKSFISISNSSSAENDNYCKHSTIVPENAAHQGANRT -SSLENHDQMSVNCRTLLSESPGKLHVEVSADLTAINGLSYNQNLANGSYDLANRDFCQGN -QLNYYKQEIPVQPTTSYSIQNLYSYENQPQPSDECTLLSNKYLDGNANKSTSDGSPVMAV -MPGTTDTIQVLKGRMDSEQSPSIGYSSRTLGPNPGLILQALTLSNASDGFNLERLEMLGD -SFLKHAITTYLFCTYPDAHEGRLSYMRSKKVSNCNLYRLGKKKGLPSRMVVSIFDPPVNW -LPPGYVVNQDKSNTDKWEKDEMTKDCMLANGKLDEDYEEEDEEEESLMWRAPKEEADYED -DFLEYDQEHIRFIDNMLMGSGAFVKKISLSPFSTTDSAYEWKMPKKSSLGSMPFSSFDED -FDYSSWDAMCYLDPSKAVEEDDFVVGFWNPSEENCGVDTGKQSISYDLHTEQCIADKSIA -DCVEALLGCYLTSCGERAAQLFLCSLGLKVLPVIKRTDREKALCPTRENFNSQQKNLSVS -CAAASVASSRSSVLKDSEYGCLKIPPRCMFDHPDADKTLNHLISGFENFEKKINYRFKNK -AYLLQAFTHASYHYNTITDCYQRLEFLGDAILDYLITKHLYEDPRQHSPGVLTDLRSALV -NNTIFASLAVKYDYHKYFKAVSPELFHVIDDFVQFQLEKNEMQGMDSELRRSEEDEEKEE -DIEVPKAMGDIFESLAGAIYMDSGMSLETVWQVYYPMMRPLIEKFSANVPRSPVRELLEM -EPETAKFSPAERTYDGKVRVTVEVVGKGKFKGVGRSYRIAKSAAARRALRSLKANQPQVP -NS""" - - fasta_input = st.text_area( - "Paste protein sequences in FASTA format", - value=default_sequence, - height=200, - help="Default sequence: DICER_HUMAN protein for demonstration" - ) - - # Get available enzymes - try: - available_enzymes = get_available_enzymes() - # convert bytes to str if necessary - available_enzymes = [enzyme.decode() if isinstance(enzyme, bytes) else enzyme for enzyme in available_enzymes] - - except Exception as e: - st.error(f"❌ Cannot load enzyme database: {e}") - st.error("Please ensure pyOpenMS is properly configured before using the digest functionality.") - st.stop() - - # Enzyme selection - enzyme_index = 0 - if DEFAULT_ENZYME in available_enzymes: - enzyme_index = available_enzymes.index(DEFAULT_ENZYME) - - enzyme = st.selectbox( - "Enzyme", - options=available_enzymes, - index=enzyme_index, - help="Select the enzyme for protein digestion" - ) - - # Parameters - col1, col2 = st.columns(2) - - with col1: - missed_cleavages = st.number_input( - "Max missed cleavages", - min_value=0, - max_value=10, - value=DEFAULT_MISSED_CLEAVAGES, - help="Maximum number of missed cleavages allowed" - ) - - with col2: - max_charges = st.number_input( - "Max charge state (N)", - min_value=1, - max_value=10, - value=DEFAULT_MAX_CHARGES, - help="Maximum charge state to calculate [M + nH]" - ) - - # Peptide length filtering - st.subheader("Peptide Length Filtering") - col3, col4 = st.columns(2) - - with col3: - min_peptide_length = st.number_input( - "Min peptide length (AA)", - min_value=1, - max_value=100, - value=DEFAULT_MIN_PEPTIDE_LENGTH, - help="Minimum peptide length in amino acids" - ) - - with col4: - max_peptide_length = st.number_input( - "Max peptide length (AA)", - min_value=1, - max_value=200, - value=DEFAULT_MAX_PEPTIDE_LENGTH, - help="Maximum peptide length in amino acids" - ) - - # Submit button - submit = st.form_submit_button("🧬 Digest Proteins", type="primary") - - # Process form submission - if submit: - if not fasta_input.strip(): - st.error("❌ Please provide FASTA sequences to digest.") - return - - # Show progress - with st.spinner("🔬 Performing in silico digest..."): - # Validate FASTA input - is_valid, error_message, sequences = validate_fasta_input(fasta_input) - - if not is_valid: - st.error(f"❌ FASTA validation failed: {error_message}") - return - - if not sequences: - st.error("❌ No valid sequences found in the input.") - return - - # Show input summary - st.success(f"✅ Successfully parsed {len(sequences)} protein sequence(s)") - - # Progress bar - progress_bar = st.progress(0, text="Initializing digest...") - - try: - # Perform digest - progress_bar.progress(30, text="Performing enzymatic digest...") - - df_results = perform_digest( - sequences=sequences, - enzyme=enzyme, - missed_cleavages=missed_cleavages, - max_charges=max_charges - ) - - progress_bar.progress(60, text="Applying peptide length filters...") - - # Apply peptide length filtering - df_results = filter_peptides_by_length( - df_results, - min_length=min_peptide_length, - max_length=max_peptide_length - ) - - progress_bar.progress(80, text="Processing results...") - - if df_results.empty: - st.warning("⚠️ No peptides were generated from the digest or all peptides were filtered out. Try adjusting the parameters or check your input sequences.") - progress_bar.empty() - return - - progress_bar.progress(100, text="Complete!") - progress_bar.empty() - - # Display results - st.subheader("📊 Digest Results") - - # Summary statistics - stats = get_digest_statistics(df_results) - - col1, col2, col3, col4 = st.columns(4) - with col1: - st.metric("Total Peptides", f"{stats['total_peptides']:,}") - with col2: - st.metric("Unique Proteins", stats['unique_proteins']) - with col3: - st.metric("Avg Length", f"{stats['avg_peptide_length']:.1f} AA") - with col4: - st.metric("Mass Range", f"{stats['mass_range'][0]:.0f}-{stats['mass_range'][1]:.0f} Da") - - # Results table - st.dataframe( - df_results, - use_container_width=True, - hide_index=True, - column_config={ - "Accession": st.column_config.TextColumn("Accession", width="small"), - "Description": st.column_config.TextColumn("Description", width="large"), - "Peptide Sequence": st.column_config.TextColumn("Peptide Sequence", width="medium"), - "Length": st.column_config.NumberColumn("Length", help="Peptide length in amino acids"), - "Start": st.column_config.TextColumn("Start", width="small", help="1-based start position(s) in protein sequence"), - "End": st.column_config.TextColumn("End", width="small", help="1-based end position(s) in protein sequence"), - "[M]": st.column_config.NumberColumn("[M]", format="%.4f"), - } - ) - - # Protein Coverage Visualization - st.subheader("🎨 Protein Coverage Visualization") - st.markdown(""" - **Sequence Coverage Analysis:** Each amino acid is colored based on how many peptides cover that position. - Hover over amino acids to see exact coverage counts. - """) - - # Calculate coverage for each protein - coverage_data = calculate_protein_coverage(df_results, sequences) - - # Display coverage for each protein - for accession, coverage_info in coverage_data.items(): - coverage_html = generate_coverage_html(accession, coverage_info) - st.markdown(coverage_html, unsafe_allow_html=True) - - # Download section - st.subheader("⬇️ Download Results") - - # Generate TSV - tsv_data = df_results.to_csv(sep="\t", index=False) - - col1, col2 = st.columns(2) - with col1: - st.download_button( - label="📄 Download as TSV", - data=tsv_data, - file_name=f"digest_results_{enzyme}_{missed_cleavages}mc.tsv", - mime="text/tab-separated-values", - help="Download results as tab-separated values file" - ) - - with col2: - csv_data = df_results.to_csv(index=False) - st.download_button( - label="📄 Download as CSV", - data=csv_data, - file_name=f"digest_results_{enzyme}_{missed_cleavages}mc.csv", - mime="text/csv", - help="Download results as comma-separated values file" - ) - - # Additional information - with st.expander("ℹ️ Digest Parameters Used"): - st.write(f"**Enzyme:** {enzyme}") - st.write(f"**Max missed cleavages:** {missed_cleavages}") - st.write(f"**Max charge states:** {max_charges}") - st.write(f"**Input sequences:** {len(sequences)}") - - except Exception as e: - progress_bar.empty() - st.exception(f"❌ An error occurred during digest: {str(e)}") - st.error("Please check your input and try again. If the problem persists, try with a simpler enzyme like Trypsin.") - - -if __name__ == "__main__": - - main() -main() \ No newline at end of file diff --git a/content/documentation.py b/content/documentation.py deleted file mode 100644 index c308213..0000000 --- a/content/documentation.py +++ /dev/null @@ -1,109 +0,0 @@ -import streamlit as st -from src.common.common import page_setup -from pathlib import Path -from docs.toppframework import content as topp_framework_content - -page_setup() - - -st.title("Documentation") - -cols = st.columns(2) - -pages = [ - "User Guide", - "Installation", - "Developers Guide: How to build app based on this template", - "Developers Guide: TOPP Workflow Framework", - "Developer Guide: Windows Executables", - "Developers Guide: Deployment", -] -page = cols[0].selectbox( - "**Content**", - pages, -) - -############################################################################################# -# User Guide -############################################################################################# - -if page == pages[0]: - with open(Path("docs", "user_guide.md"), "r", encoding="utf-8") as f: - content = f.read() - st.markdown(content) - -############################################################################################# -# Installation -############################################################################################# - -if page == pages[1]: - if Path("OpenMS-App.zip").exists(): - st.markdown( - """ -Download the latest version for **Windows** here clicking the button below. -""" - ) - with open("OpenMS-App.zip", "rb") as file: - st.download_button( - label="Download for Windows", - data=file, - file_name="OpenMS-App.zip", - mime="archive/zip", - type="primary", - ) - with open(Path("docs", "installation.md"), "r", encoding="utf-8") as f: - content = f.read() - st.markdown(content) - -############################################################################################# -# Developer Overview, how to build app based on Template -############################################################################################# - -if page == pages[2]: - with open(Path("docs", "build_app.md"), "r", encoding="utf-8") as f: - content = f.read() - st.markdown(content) - -############################################################################################# -# TOPP Workflow Framework -############################################################################################# - -if page == pages[3]: - topp_framework_content() - -############################################################################################# -# Windows Executables -############################################################################################# - -if page == pages[4]: - st.markdown( - """ -## 💻 How to package everything for Windows executables - -This guide explains how to package OpenMS apps into Windows executables using two different methods: -""" - ) - - tabs = ["**embeddable Python**", "**PyInstaller**"] - tabs = st.tabs(tabs) - - # window executable with embeddable python - with tabs[0]: - with open(Path("docs", "win_exe_with_embed_py.md"), "r", encoding="utf-8") as f: - content = f.read() - st.markdown(content) - - # window executable with pyinstaller - with tabs[1]: - with open(Path("docs", "win_exe_with_pyinstaller.md"), "r", encoding="utf-8") as f: - content = f.read() - st.markdown(content) - -############################################################################################# -# Deployment -############################################################################################# - -if page == pages[5]: - with open(Path("docs", "deployment.md"), "r", encoding="utf-8") as f: - content = f.read() - st.markdown(content) \ No newline at end of file diff --git a/content/download_section.py b/content/download_section.py deleted file mode 100644 index 8856a7b..0000000 --- a/content/download_section.py +++ /dev/null @@ -1,74 +0,0 @@ -import streamlit as st - -from pathlib import Path -import shutil - -from src.common.common import page_setup -from zipfile import ZipFile, ZIP_DEFLATED - -page_setup() - -# Define output folder here; all subfolders will be handled as downloadable -# directories -output_folder = 'mzML-workflow-results' - - -# Generate full path -dirpath = Path(st.session_state["workspace"], output_folder) - -# Detect downloadable content -if dirpath.exists(): - directories = sorted( - [entry for entry in dirpath.iterdir() if not entry.is_file()] - ) -else: - directories = [] - -# Show error if no content is available for download -if len(directories) == 0: - st.error('No results to show yet. Please run a workflow first!') -else: - # Table Header - columns = st.columns(3) - columns[0].write('**Run**') - columns[1].write('**Download**') - columns[2].write('**Delete Result Set**') - - # Table Body - for i, directory in enumerate(directories): - st.divider() - columns = st.columns(3) - columns[0].empty().write(directory.name) - - with columns[1]: - button_placeholder = st.empty() - - # Show placeholder button before download is prepared - clicked = button_placeholder.button('Prepare Download', key=i, use_container_width=True) - if clicked: - button_placeholder.empty() - with st.spinner(): - # Create ZIP file - out_zip = Path(directory, 'output.zip') - if not out_zip.exists(): - with ZipFile(out_zip, 'w', ZIP_DEFLATED) as zip_file: - for output in Path(directory).iterdir(): - if output.name == 'output.zip': - continue - try: - with open(output, 'r') as f: - zip_file.writestr(output.name, f.read()) - except: - continue - # Show download button after ZIP file was created - with open(out_zip, 'rb') as f: - button_placeholder.download_button( - "Download ⬇️", f, - file_name = f'{directory.name}.zip', - use_container_width=True - ) - - with columns[2]: - if st.button(f"🗑️ {directory.name}", use_container_width=True): - shutil.rmtree(directory) - st.rerun() \ No newline at end of file diff --git a/content/file_upload.py b/content/file_upload.py deleted file mode 100644 index e6acc56..0000000 --- a/content/file_upload.py +++ /dev/null @@ -1,133 +0,0 @@ -from pathlib import Path - -import streamlit as st -import pandas as pd - -from src.common.common import ( - page_setup, - save_params, - v_space, - show_table, - TK_AVAILABLE, - tk_directory_dialog, -) -from src import fileupload - -params = page_setup() - -st.title("File Upload") - -# Check if there are any files in the workspace -mzML_dir = Path(st.session_state.workspace, "mzML-files") -if not any(Path(mzML_dir).iterdir()): - # No files present, load example data - fileupload.load_example_mzML_files() - -tabs = ["File Upload"] -if st.session_state.location == "local": - tabs.append("Files from local folder") - -tabs = st.tabs(tabs) - -with tabs[0]: - with st.form("mzML-upload", clear_on_submit=True): - files = st.file_uploader( - "mzML files", accept_multiple_files=(st.session_state.location == "local") - ) - cols = st.columns(3) - if cols[1].form_submit_button("Add files to workspace", type="primary"): - if files: - fileupload.save_uploaded_mzML(files) - else: - st.warning("Select files first.") - -# Local file upload option: via directory path -if st.session_state.location == "local": - with tabs[1]: - st_cols = st.columns([0.05, 0.95], gap="small") - with st_cols[0]: - st.write("\n") - st.write("\n") - dialog_button = st.button( - "📁", - key="local_browse", - help="Browse for your local directory with MS data.", - disabled=not TK_AVAILABLE, - ) - if dialog_button: - st.session_state["local_dir"] = tk_directory_dialog( - "Select directory with your MS data", - st.session_state["previous_dir"], - ) - st.session_state["previous_dir"] = st.session_state["local_dir"] - with st_cols[1]: - # with st.form("local-file-upload"): - local_mzML_dir = st.text_input( - "path to folder with mzML files", value=st.session_state["local_dir"] - ) - # raw string for file paths - local_mzML_dir = rf"{local_mzML_dir}" - cols = st.columns([0.65, 0.3, 0.4, 0.25], gap="small") - copy_button = cols[1].button( - "Copy files to workspace", type="primary", disabled=(local_mzML_dir == "") - ) - use_copy = cols[2].checkbox( - "Make a copy of files", - key="local_browse-copy_files", - value=True, - help="Create a copy of files in workspace.", - ) - if not use_copy: - st.warning( - "**Warning**: You have deselected the `Make a copy of files` option. " - "This **_assumes you know what you are doing_**. " - "This means that the original files will be used instead. " - ) - if copy_button: - fileupload.copy_local_mzML_files_from_directory(local_mzML_dir, use_copy) - -if any(Path(mzML_dir).iterdir()): - v_space(2) - # Display all mzML files currently in workspace - df = pd.DataFrame( - { - "file name": [ - f.name - for f in Path(mzML_dir).iterdir() - if "external_files.txt" not in f.name - ] - } - ) - - # Check if local files are available - external_files = Path(mzML_dir, "external_files.txt") - if external_files.exists(): - with open(external_files, "r") as f_handle: - external_files = f_handle.readlines() - external_files = [f.strip() for f in external_files] - df = pd.concat( - [df, pd.DataFrame({"file name": external_files})], ignore_index=True - ) - - st.markdown("##### mzML files in current workspace:") - show_table(df) - v_space(1) - # Remove files - with st.expander("🗑️ Remove mzML files"): - to_remove = st.multiselect( - "select mzML files", options=[f.stem for f in sorted(mzML_dir.iterdir())] - ) - c1, c2 = st.columns(2) - if c2.button( - "Remove **selected**", type="primary", disabled=not any(to_remove) - ): - params = fileupload.remove_selected_mzML_files(to_remove, params) - save_params(params) - st.rerun() - - if c1.button("⚠️ Remove **all**", disabled=not any(mzML_dir.iterdir())): - params = fileupload.remove_all_mzML_files(params) - save_params(params) - st.rerun() - -save_params(params) diff --git a/content/fragmentation.py b/content/fragmentation.py deleted file mode 100644 index 1cb8126..0000000 --- a/content/fragmentation.py +++ /dev/null @@ -1,799 +0,0 @@ -import io -import re -from typing import Tuple, Dict, Any, Optional, List - -import plotly.graph_objects as go -import streamlit as st -import pyopenms as oms -import pandas as pd - -from src.common.common import page_setup, show_fig - -params = page_setup() - -# Ion type configuration -ION_TYPES = { - 'a': {'name': 'a-ions', 'description': 'N-terminal ions (peptide bond + loss of CO)', 'param': 'add_a_ions'}, - 'b': {'name': 'b-ions', 'description': 'N-terminal ions (peptide bond cleavage)', 'param': 'add_b_ions'}, - 'c': {'name': 'c-ions', 'description': 'N-terminal ions (N-Cα bond cleavage)', 'param': 'add_c_ions'}, - 'x': {'name': 'x-ions', 'description': 'C-terminal ions (N-Cα bond + addition of CO)', 'param': 'add_x_ions'}, - 'y': {'name': 'y-ions', 'description': 'C-terminal ions (peptide bond cleavage)', 'param': 'add_y_ions'}, - 'z': {'name': 'z-ions', 'description': 'C-terminal ions (N-Cα bond cleavage)', 'param': 'add_z_ions'} -} - -def validate_peptide_sequence(sequence_str: str) -> Tuple[bool, str, Optional[str]]: - """Validate a peptide sequence for fragmentation. - - Args: - sequence_str (str): The amino acid sequence - - Returns: - Tuple[bool, str, Optional[str]]: (is_valid, error_message, clean_sequence) - """ - try: - # Clean the sequence - sequence_str = sequence_str.strip().upper() - if not sequence_str: - return False, "Sequence cannot be empty", None - - # Remove common formatting characters - clean_sequence = re.sub(r'[^ACDEFGHIKLMNPQRSTVWYXU]', '', sequence_str) - - if not clean_sequence: - return False, "No valid amino acid letters found", None - - # Check minimum length for fragmentation - if len(clean_sequence) < 2: - return False, "Sequence must be at least 2 amino acids long for fragmentation", None - - # Validate amino acids - valid_aa = set("ACDEFGHIKLMNPQRSTVWYXU") - invalid_chars = [aa for aa in clean_sequence if aa not in valid_aa] - - if invalid_chars: - invalid_list = ", ".join(sorted(set(invalid_chars))) - return False, f"Invalid amino acid(s): {invalid_list}", None - - return True, "", clean_sequence - - except Exception as e: - return False, f"Error validating sequence: {str(e)}", None - -def configure_spectrum_generator(ion_types: List[str], max_charge: int = 2) -> oms.TheoreticalSpectrumGenerator: - """Configure the TheoreticalSpectrumGenerator with selected ion types. - - Args: - ion_types (List[str]): List of ion type keys to enable - max_charge (int): Maximum charge state to consider - - Returns: - oms.TheoreticalSpectrumGenerator: Configured generator - """ - tsg = oms.TheoreticalSpectrumGenerator() - param = oms.Param() - - # Disable all ion types first - for ion_key, ion_info in ION_TYPES.items(): - param.setValue(ion_info['param'], "false") - - # Enable selected ion types - for ion_type in ion_types: - if ion_type in ION_TYPES: - param.setValue(ION_TYPES[ion_type]['param'], "true") - - # Set other parameters - param.setValue("add_first_prefix_ion", "true") - param.setValue("add_losses", "false") # Disable neutral losses for simplicity - param.setValue("add_metainfo", "true") - param.setValue("add_isotopes", "false") # Disable isotopes for cleaner spectra - param.setValue("max_isotope", 2) - param.setValue("rel_loss_intensity", 0.1) - - tsg.setParameters(param) - return tsg - -def generate_theoretical_spectrum(sequence_str: str, ion_types: List[str], charges: List[int]) -> Dict[str, Any]: - """Generate theoretical fragment spectrum for a peptide sequence. - - Args: - sequence_str (str): The amino acid sequence - ion_types (List[str]): List of ion types to include - charges (List[int]): List of charge states to consider - - Returns: - Dict[str, Any]: Results dictionary with fragment data - """ - try: - # Validate sequence - is_valid, error_msg, clean_sequence = validate_peptide_sequence(sequence_str) - if not is_valid: - return {"success": False, "error": error_msg} - - if not ion_types: - return {"success": False, "error": "Please select at least one ion type"} - - if not charges: - return {"success": False, "error": "Please select at least one charge state"} - - # Create AASequence object - aa_sequence = oms.AASequence.fromString(clean_sequence) - - # Configure spectrum generator - max_charge = max(charges) - tsg = configure_spectrum_generator(ion_types, max_charge) - - # Generate spectra for each charge state - all_fragments = [] - - for charge in charges: - spectrum = oms.MSSpectrum() - tsg.getSpectrum(spectrum, aa_sequence, charge, charge) - - # Extract peak data with annotations from StringDataArrays - mzs = spectrum.get_peaks()[0] - intensities = spectrum.get_peaks()[1] - - # Get annotations from StringDataArrays - annotations = [] - if spectrum.getStringDataArrays(): - annotations = list(spectrum.getStringDataArrays()[0]) - annotations = [ann.decode('utf-8') if isinstance(ann, bytes) else ann for ann in annotations] - - # If no annotations available, create empty list - if not annotations: - annotations = [''] * len(mzs) - - for mz, intensity, annotation in zip(mzs, intensities, annotations): - # Parse ion information from annotation - ion_info = parse_ion_annotation(annotation, mz, clean_sequence) - - all_fragments.append({ - 'mz': mz, - 'intensity': intensity, - 'charge': charge, - 'ion_type': ion_info.get('ion_type', 'unknown'), - 'fragment_number': ion_info.get('fragment_number', 0), - 'sequence': ion_info.get('fragment_sequence', ''), - 'annotation': annotation if annotation else f'm/z {mz:.4f}' - }) - - # Convert to DataFrame - df = pd.DataFrame(all_fragments) - df = df.sort_values(['ion_type', 'fragment_number', 'charge']) - - return { - "success": True, - "fragments": df, - "sequence": clean_sequence, - "ion_types": ion_types, - "charges": charges, - "input_value": sequence_str - } - - except Exception as e: - return {"success": False, "error": f"Error generating spectrum: {str(e)}"} - -def parse_ion_annotation(annotation, mz: float, peptide_sequence: str = '') -> Dict[str, Any]: - """Parse ion annotation string from pyOpenMS to extract ion information. - - Args: - annotation: The annotation from StringDataArrays (str or bytes) - mz (float): The m/z value - peptide_sequence (str): The full peptide sequence - - Returns: - Dict[str, Any]: Parsed ion information - """ - # Handle bytes objects from pyOpenMS - if isinstance(annotation, bytes): - annotation = annotation.decode('utf-8') - - # Convert to string if needed - annotation = str(annotation) if annotation is not None else '' - - if not annotation: - return { - 'ion_type': 'unknown', - 'fragment_number': 0, - 'fragment_sequence': '', - 'annotation': f'm/z {mz:.4f}' - } - - # Parse annotation like "b3+", "y5++", etc. - - # Match pattern: ion_type + number + charges - match = re.match(r'([abcxyz])(\d+)(\+*)', annotation) - if match: - ion_type = match.group(1) - fragment_number = int(match.group(2)) - charges = len(match.group(3)) - - # Calculate fragment sequence - fragment_sequence = '' - if peptide_sequence and fragment_number > 0: - if ion_type in ['a', 'b', 'c']: # N-terminal ions - if fragment_number <= len(peptide_sequence): - fragment_sequence = peptide_sequence[:fragment_number] - elif ion_type in ['x', 'y', 'z']: # C-terminal ions - if fragment_number <= len(peptide_sequence): - fragment_sequence = peptide_sequence[-fragment_number:] - - return { - 'ion_type': ion_type, - 'fragment_number': fragment_number, - 'fragment_sequence': fragment_sequence, - 'annotation': annotation - } - - # If parsing fails, return unknown - return { - 'ion_type': 'unknown', - 'fragment_number': 0, - 'fragment_sequence': '', - 'annotation': annotation - } - -def annotate_fragment(mz: float, aa_sequence: oms.AASequence, charge: int, ion_types: List[str]) -> Dict[str, Any]: - """Annotate a fragment peak with ion type and fragment number. - - Args: - mz (float): The m/z value of the fragment - aa_sequence (oms.AASequence): The original sequence - charge (int): The charge state - ion_types (List[str]): Enabled ion types - - Returns: - Dict[str, Any]: Annotation information - """ - sequence_str = aa_sequence.toString() - sequence_length = len(sequence_str) - - # Calculate theoretical masses for different fragment types - for ion_type in ion_types: - if ion_type in ['a', 'b', 'c']: # N-terminal ions - for i in range(1, sequence_length): - fragment_seq = sequence_str[:i] - fragment_aa_seq = oms.AASequence.fromString(fragment_seq) - - # Calculate theoretical m/z for this ion type - theoretical_mz = calculate_ion_mz(fragment_aa_seq, ion_type, charge) - - # Check if this matches our observed m/z (within tolerance) - if abs(mz - theoretical_mz) < 0.01: # 0.01 Da tolerance - return { - 'ion_type': ion_type, - 'fragment_number': i, - 'fragment_sequence': fragment_seq, - 'annotation': f'{ion_type}{i}{"+" * charge}' - } - - elif ion_type in ['x', 'y', 'z']: # C-terminal ions - for i in range(1, sequence_length): - fragment_seq = sequence_str[-i:] - fragment_aa_seq = oms.AASequence.fromString(fragment_seq) - - # Calculate theoretical m/z for this ion type - theoretical_mz = calculate_ion_mz(fragment_aa_seq, ion_type, charge) - - # Check if this matches our observed m/z (within tolerance) - if abs(mz - theoretical_mz) < 0.01: # 0.01 Da tolerance - return { - 'ion_type': ion_type, - 'fragment_number': i, - 'fragment_sequence': fragment_seq, - 'annotation': f'{ion_type}{i}{"+" * charge}' - } - - # Default annotation if no match found - return { - 'ion_type': 'unknown', - 'fragment_number': 0, - 'fragment_sequence': '', - 'annotation': f'm/z {mz:.4f}{"+" * charge}' - } - -def calculate_ion_mz(fragment_sequence: oms.AASequence, ion_type: str, charge: int) -> float: - """Calculate theoretical m/z for a fragment ion. - - Args: - fragment_sequence (oms.AASequence): The fragment sequence - ion_type (str): The ion type (a, b, c, x, y, z) - charge (int): The charge state - - Returns: - float: Theoretical m/z value - """ - mass = fragment_sequence.getMonoWeight() - - # Apply ion type specific mass adjustments - if ion_type == 'a': - mass -= 27.994915 # -CO - elif ion_type == 'b': - mass += 0.0 # No adjustment - elif ion_type == 'c': - mass += 17.026549 # +NH3 - elif ion_type == 'x': - mass += 25.980218 # +CO -H - elif ion_type == 'y': - mass += 18.010565 # +H2O - elif ion_type == 'z': - mass += 0.984016 # +H -NH2 - - # Add protons for charge - mass += charge * 1.007276 - - return mass / charge - -def create_fragmentation_plot(result_data: Dict[str, Any]) -> go.Figure: - """Create the fragmentation spectrum plot. - - Args: - result_data (Dict[str, Any]): Results from spectrum generation - - Returns: - go.Figure: Plotly figure object - """ - df = result_data["fragments"] - print(df) - # Color map for ion types - color_map = { - 'a': '#FF6B6B', # Red - 'b': '#4ECDC4', # Teal - 'c': '#45B7D1', # Blue - 'x': '#96CEB4', # Green - 'y': '#FFEAA7', # Yellow - 'z': '#DDA0DD', # Plum - 'unknown': '#95A5A6' # Gray - } - - fig = go.Figure() - - # Add traces for each ion type - for ion_type in df['ion_type'].unique(): - ion_data = df[df['ion_type'] == ion_type] - - fig.add_trace(go.Scatter( - x=ion_data['mz'], - y=ion_data['intensity'], - mode='markers+lines', - name=ION_TYPES.get(ion_type, {}).get('name', ion_type), - marker=dict( - color=color_map.get(ion_type, '#95A5A6'), - size=8 - ), - line=dict(width=0), - text=ion_data['annotation'], - hovertemplate="%{text}
" + - "m/z: %{x:.4f}
" + - "Intensity: %{y:.1e}
" + - "" - )) - - # Add stem lines - for _, row in ion_data.iterrows(): - fig.add_shape( - type="line", - x0=row['mz'], y0=0, - x1=row['mz'], y1=row['intensity'], - line=dict(color=color_map.get(ion_type, '#95A5A6'), width=2) - ) - - fig.update_layout( - title=f"Theoretical Fragment Spectrum: {result_data['sequence']}", - xaxis_title="m/z", - yaxis_title="Relative Intensity", - hovermode='closest', - showlegend=True, - height=500 - ) - - return fig - -# UI Implementation -st.title("💥 Peptide Fragmentation Calculator") - -st.markdown(""" -Generate theoretical fragment ion spectra for peptide sequences using pyOpenMS. -Select ion types and charge states to customize the fragmentation pattern. -""") - -# Documentation section -with st.expander("📚 Documentation", expanded=False): - st.markdown(""" - ## Overview - - The Peptide Fragmentation Calculator generates theoretical fragment ion spectra for peptide sequences using the - powerful **pyOpenMS** library. This tool simulates what would happen when a peptide is fragmented in a mass - spectrometer, providing essential information for mass spectrometry analysis and peptide identification. - - ## Peptide Fragmentation Theory - - When peptides are subjected to collision-induced dissociation (CID) or higher-energy collisional dissociation (HCD) - in a mass spectrometer, they fragment primarily along the peptide backbone. The fragmentation produces two series - of ions: - - - **N-terminal ions**: Contain the N-terminus of the original peptide - - **C-terminal ions**: Contain the C-terminus of the original peptide - - ### Ion Types Explained - - #### N-terminal Fragment Ions - - **a-ions**: Result from cleavage of the C-N bond with loss of CO (carbonyl group) - - Formula: [M + H - CO]⁺ where M is the N-terminal fragment mass - - Less commonly observed in standard CID conditions - - - **b-ions**: Result from cleavage of the peptide bond (amide bond) - - Formula: [M + H]⁺ where M is the N-terminal fragment mass - - Most abundant N-terminal ions in CID spectra - - - **c-ions**: Result from cleavage of the N-Cα bond with retention of NH₃ - - Formula: [M + H + NH₃]⁺ where M is the N-terminal fragment mass - - More common in ETD (electron transfer dissociation) conditions - - #### C-terminal Fragment Ions - - **x-ions**: Result from cleavage of the N-Cα bond with addition of CO - - Formula: [M + H + CO - H]⁺ where M is the C-terminal fragment mass - - Less commonly observed - - - **y-ions**: Result from cleavage of the peptide bond with addition of H₂O - - Formula: [M + H + H₂O]⁺ where M is the C-terminal fragment mass - - Most abundant C-terminal ions in CID spectra - - - **z-ions**: Result from cleavage of the N-Cα bond with loss of NH₂ - - Formula: [M + H - NH₂]⁺ where M is the C-terminal fragment mass - - More common in ETD conditions - - ## Usage Instructions - - ### 1. Enter Peptide Sequence - - Use standard single-letter amino acid codes (A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y) - - Extended codes (X, U) are also supported - - Minimum sequence length: 2 amino acids - - Example: `PEPTIDE`, `SAMPLESEQUENCE`, `ACDEFGHIK` - - ### 2. Select Ion Types - - Choose which fragment ion types to include in the spectrum - - **Recommended for CID/HCD**: b-ions and y-ions (default selection) - - **For ETD analysis**: Add c-ions and z-ions - - **Comprehensive analysis**: Select all ion types - - ### 3. Choose Charge States - - Select the charge states to consider (1+ to 5+) - - **Typical choice**: 1+ and 2+ for most peptides - - **For longer peptides**: Include higher charge states (3+, 4+) - - Higher charge states produce fragments at lower m/z values - - ### 4. Interpret Results - - #### Spectrum Plot - - **X-axis**: m/z (mass-to-charge ratio) - - **Y-axis**: Relative intensity (theoretical, normalized) - - **Colors**: Different colors represent different ion types - - **Hover**: Shows detailed information for each peak - - #### Fragment Table - - **Ion Type**: The type of fragment ion (a, b, c, x, y, z) - - **Fragment**: The fragment number (position from terminus) - - **Charge**: The charge state of the fragment - - **m/z**: The theoretical mass-to-charge ratio - - **Sequence**: The amino acid sequence of the fragment - - ## Technical Details - - ### Algorithm - - Uses pyOpenMS `TheoreticalSpectrumGenerator` class - - Calculates exact monoisotopic masses for fragments - - Applies ion-type specific mass corrections - - Supports multiple charge states simultaneously - - ### Mass Calculations - The theoretical m/z values are calculated using: - ``` - m/z = (fragment_mass + ion_type_correction + charge × proton_mass) / charge - ``` - - Where: - - `fragment_mass`: Exact monoisotopic mass of the amino acid sequence - - `ion_type_correction`: Ion-specific mass adjustment (see ion types above) - - `proton_mass`: 1.007276 Da - - `charge`: The charge state (1, 2, 3, etc.) - - ### Parameters - - **Isotopes**: Disabled for cleaner spectra (monoisotopic peaks only) - - **Neutral losses**: Disabled by default for simplicity - - **Mass accuracy**: Calculated to 4 decimal places - - **Intensity**: Relative theoretical intensities (not experimental) - - ## Example Workflows - - ### Basic Peptide Analysis - 1. Enter sequence: `PEPTIDE` - 2. Select: b-ions and y-ions - 3. Charge states: 1+ and 2+ - 4. Expected fragments: b₁-b₆, y₁-y₆ ions - - ### Comprehensive Fragmentation - 1. Enter sequence: `SAMPLESEQUENCE` - 2. Select: All ion types - 3. Charge states: 1+, 2+, 3+ - 4. Results: Complete fragmentation pattern - - ### ETD Simulation - 1. Enter sequence: `PEPTIDE` - 2. Select: c-ions and z-ions - 3. Charge states: 1+ and 2+ - 4. Results: ETD-like fragmentation pattern - - ## Troubleshooting - - ### Common Issues - - **"Sequence cannot be empty"** - - Solution: Enter a valid amino acid sequence - - **"Invalid amino acid(s): X"** - - Solution: Check for typos or non-standard amino acid codes - - Use only standard single-letter codes - - **"Sequence must be at least 2 amino acids long"** - - Solution: Enter a longer peptide sequence - - Single amino acids cannot be fragmented - - **"Please select at least one ion type"** - - Solution: Check at least one ion type checkbox - - **"Please select at least one charge state"** - - Solution: Select at least one charge state from the dropdown - - ### Performance Notes - - Longer sequences (>20 amino acids) may take longer to process - - Higher charge states increase computation time - - All ion types selected will generate more fragments - - ## Applications - - ### Mass Spectrometry Method Development - - Design targeted MS/MS experiments - - Optimize fragmentation conditions - - Predict optimal precursor charge states - - ### Peptide Identification - - Compare experimental spectra with theoretical fragments - - Validate peptide sequence assignments - - Understand fragmentation efficiency - - ### Educational Purposes - - Learn peptide fragmentation patterns - - Understand ion nomenclature - - Explore charge state effects - - ## References and Further Reading - - ### Key Publications - 1. **Roepstorff, P. & Fohlman, J.** (1984). Proposal for a common nomenclature for sequence ions in mass spectra of peptides. *Biomed. Mass Spectrom.* 11, 601. - - 2. **Senko, M.W. et al.** (1995). Determination of monoisotopic masses and ion populations for large biomolecules from resolved isotopic distributions. *J. Am. Soc. Mass Spectrom.* 6, 229-233. - - 3. **Hunt, D.F. et al.** (1986). Protein sequencing by tandem mass spectrometry. *Proc. Natl. Acad. Sci. USA* 83, 6233-6237. - - ### Software and Tools - - **pyOpenMS**: Open-source mass spectrometry library ([www.openms.de](https://www.openms.de)) - - **NIST Mass Spectral Database**: Reference spectra and fragmentation patterns - - **Protein Prospector**: Online MS tools from UCSF - - ### Educational Resources - - **Mass Spectrometry: A Textbook** by Jürgen H. Gross - - **Introduction to Mass Spectrometry** by J. Throck Watson - - Online tutorials at [www.massspecpedia.com](http://www.massspecpedia.com) - - --- - - 💡 **Tip**: Start with the default settings (b-ions and y-ions, charges 1+ and 2+) for most peptides, - then customize based on your specific analytical needs. - """) - -col1, col2 = st.columns([1, 1]) - -with col1: - st.subheader("Input Parameters") - - # Peptide sequence input - sequence_input = st.text_area( - "Peptide Sequence:", - value="PEPTIDE", - height=200, - help="""Enter the peptide sequence using single-letter amino acid codes: - -• Standard amino acids: A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y -• Extended codes: X (any amino acid), U (selenocysteine) -• Minimum length: 2 amino acids for fragmentation -• Spaces and non-letter characters will be automatically removed - -Examples: PEPTIDE, ACDEFGHIK, SAMPLESEQUENCE""" - ) - - # Ion type selection - st.write("**Ion Types:**") - st.caption("Select which fragment ion types to include in the theoretical spectrum") - ion_types = [] - - col_ions1, col_ions2 = st.columns(2) - - with col_ions1: - st.markdown("**N-terminal ions:**") - if st.checkbox("a-ions", help="""a-ions: N-terminal fragments with CO loss - -• Formation: Cleavage at peptide bond + loss of CO (28 Da) -• Formula: [M + H - CO]⁺ -• Abundance: Low in CID, moderate in high-energy conditions -• Mass shift: -27.99 Da from corresponding b-ion"""): - ion_types.append('a') - if st.checkbox("b-ions", value=True, help="""b-ions: Most common N-terminal fragments - -• Formation: Direct cleavage at peptide bond (amide bond) -• Formula: [M + H]⁺ where M = N-terminal fragment mass -• Abundance: High in CID/HCD spectra (dominant N-terminal series) -• Nomenclature: b₁, b₂, b₃... numbered from N-terminus"""): - ion_types.append('b') - if st.checkbox("c-ions", help="""c-ions: N-terminal fragments with NH₃ retention - -• Formation: Cleavage at N-Cα bond + retention of NH₃ -• Formula: [M + H + NH₃]⁺ -• Abundance: High in ETD/ECD, low in CID -• Mass shift: +17.03 Da from corresponding b-ion"""): - ion_types.append('c') - - with col_ions2: - st.markdown("**C-terminal ions:**") - if st.checkbox("x-ions", help="""x-ions: C-terminal fragments with CO addition - -• Formation: Cleavage at N-Cα bond + addition of CO -• Formula: [M + H + CO - H]⁺ -• Abundance: Low in most fragmentation methods -• Mass shift: +25.98 Da from corresponding y-ion"""): - ion_types.append('x') - if st.checkbox("y-ions", value=True, help="""y-ions: Most common C-terminal fragments - -• Formation: Cleavage at peptide bond + addition of H₂O -• Formula: [M + H + H₂O]⁺ where M = C-terminal fragment mass -• Abundance: High in CID/HCD spectra (dominant C-terminal series) -• Nomenclature: y₁, y₂, y₃... numbered from C-terminus"""): - ion_types.append('y') - if st.checkbox("z-ions", help="""z-ions: C-terminal fragments with NH₂ loss - -• Formation: Cleavage at N-Cα bond + loss of NH₂ -• Formula: [M + H - NH₂]⁺ -• Abundance: High in ETD/ECD, low in CID -• Mass shift: +0.98 Da from corresponding y-ion"""): - ion_types.append('z') - - # Charge state selection - charges = st.multiselect( - "Charge States:", - options=[1, 2, 3, 4, 5], - default=[1, 2], - help="""Select charge states to include in the theoretical spectrum: - -• 1+: Singly charged fragments (most common for short peptides) -• 2+: Doubly charged fragments (common for longer peptides) -• 3+ and higher: Multiple charges (for long peptides, lower m/z values) - -Higher charge states: -- Produce fragments at lower m/z ratios -- Are more common with longer peptide sequences -- May improve fragmentation coverage -- Require higher precursor charge states""" - ) - - # Initialize result_data - result_data = None - - # Generate button - if st.button('Generate Fragment Spectrum', type='primary'): - with st.spinner('Generating theoretical spectrum...'): - result_data = generate_theoretical_spectrum(sequence_input, ion_types, charges) - -with col2: - st.subheader("Results") - - if result_data: - if result_data["success"]: - # Display basic info - st.write(f"**Sequence:** {result_data['sequence']}") - st.write(f"**Ion Types:** {', '.join([ION_TYPES[ion]['name'] for ion in result_data['ion_types']])}") - st.write(f"**Charge States:** {', '.join(map(str, result_data['charges']))}") - st.write(f"**Total Fragments:** {len(result_data['fragments'])}") - - # Summary by ion type - if len(result_data['fragments']) > 0: - summary = result_data['fragments'].groupby('ion_type').size() - st.write("**Fragments by Ion Type:**") - for ion_type, count in summary.items(): - ion_name = ION_TYPES.get(ion_type, {}).get('name', ion_type) - st.write(f"- {ion_name}: {count}") - else: - st.error(f"Error: {result_data['error']}") - -# Display plot and data table -if 'result_data' in locals() and result_data and result_data["success"]: - # Create and display plot - fig = create_fragmentation_plot(result_data) - show_fig(fig, 'Fragment Spectrum') - - # Display fragment table - st.subheader("Fragment Ion Table") - - # Format the dataframe for display - display_df = result_data['fragments'].copy() - display_df['m/z'] = display_df['mz'].round(4) - display_df['Ion Type'] = display_df['ion_type'].map(lambda x: ION_TYPES.get(x, {}).get('name', x)) - display_df['Fragment'] = display_df['fragment_number'] - display_df['Charge'] = display_df['charge'].astype(str) + '+' - display_df['Sequence'] = display_df['sequence'] - #display_df['Intensity'] = display_df['intensity'].apply(lambda x: f"{x:.2e}") - - # Select columns for display - display_columns = ['Ion Type', 'Fragment', 'Charge', 'm/z', - #'Intensity', - 'Sequence'] - st.dataframe(display_df[display_columns], use_container_width=True) - - # Download options - st.subheader("Export Options") - - # Prepare TSV data - tsv_buffer = io.StringIO() - display_df[display_columns].to_csv(tsv_buffer, sep='\t', index=False) - tsv_buffer.seek(0) - tsv_data = tsv_buffer.getvalue() - - # Try to create Excel file with xlsxwriter, fallback to TSV if not available - xlsx_available = True - xlsx_data = None - xlsx_error_msg = None - - try: - xlsx_buffer = io.BytesIO() - with pd.ExcelWriter(xlsx_buffer, engine="xlsxwriter") as writer: - display_df[display_columns].to_excel(writer, index=False, sheet_name="Fragment Ions") - xlsx_buffer.seek(0) - xlsx_data = xlsx_buffer.getvalue() - except ImportError as e: - xlsx_available = False - xlsx_error_msg = "xlsxwriter module not available" - st.warning("⚠️ Excel export unavailable: xlsxwriter module not found. Using TSV format as fallback.") - except Exception as e: - xlsx_available = False - xlsx_error_msg = f"Excel export error: {str(e)}" - st.warning(f"⚠️ Excel export failed: {str(e)}. Using TSV format as fallback.") - - if xlsx_available: - col_tsv, col_xlsx = st.columns(2) - else: - col_tsv, col_tsv_fallback = st.columns(2) - - with col_tsv: - st.download_button( - label="Download TSV", - data=tsv_data, - file_name=f"fragments_{result_data['sequence']}.tsv", - mime="text/tab-separated-values" - ) - - if xlsx_available: - with col_xlsx: - st.download_button( - label="Download Excel", - data=xlsx_data, - file_name=f"fragments_{result_data['sequence']}.xlsx", - mime="application/vnd.openxmlformats-officedocument.spreadsheetml.sheet" - ) - else: - with col_tsv_fallback: - st.download_button( - label="Download TSV (Excel fallback)", - data=tsv_data, - file_name=f"fragments_{result_data['sequence']}_fallback.tsv", - mime="text/tab-separated-values", - help="Excel export unavailable, downloading as TSV instead" - ) diff --git a/content/isotope_pattern_generator.py b/content/isotope_pattern_generator.py deleted file mode 100644 index 680d2d0..0000000 --- a/content/isotope_pattern_generator.py +++ /dev/null @@ -1,625 +0,0 @@ -import io -import re -from typing import Tuple, Dict, Any, Optional - -import plotly.graph_objects as go -import streamlit as st -import pyopenms as oms -import pandas as pd -import numpy as np - -from src.common.common import page_setup, show_fig - -params = page_setup() - -# Initialize pattern generators -coarse_pattern_generator = oms.CoarseIsotopePatternGenerator() -fine_pattern_generator = oms.FineIsotopePatternGenerator() - -pd.options.plotting.backend = "ms_plotly" - -def validate_elemental_formula(formula_str: str) -> Tuple[bool, str, Optional[oms.EmpiricalFormula]]: - """Validate an elemental formula string using pyOpenMS. - - Args: - formula_str (str): The elemental formula string (e.g., "C100H150N26O30S1") - - Returns: - Tuple[bool, str, Optional[EmpiricalFormula]]: (is_valid, error_message, formula_object) - """ - try: - # Clean the formula string - formula_str = formula_str.strip() - if not formula_str: - return False, "Formula cannot be empty", None - - # Try to parse with pyOpenMS - empirical_formula = oms.EmpiricalFormula(formula_str) - - return True, "", empirical_formula - - except Exception as e: - return False, f"Invalid formula format: {str(e)}", None - -def validate_peptide_sequence(sequence_str: str) -> Tuple[bool, str, Optional[str]]: - """Validate a peptide/protein sequence. - - Args: - sequence_str (str): The amino acid sequence - - Returns: - Tuple[bool, str, Optional[str]]: (is_valid, error_message, clean_sequence) - """ - try: - # Clean the sequence - sequence_str = sequence_str.strip().upper() - if not sequence_str: - return False, "Sequence cannot be empty", None - - # Remove common formatting characters - clean_sequence = re.sub(r'[^ACDEFGHIKLMNPQRSTVWYXU]', '', sequence_str) - - if not clean_sequence: - return False, "No valid amino acid letters found", None - - # Validate amino acids - valid_aa = set("ACDEFGHIKLMNPQRSTVWYXU") - invalid_chars = [aa for aa in clean_sequence if aa not in valid_aa] - - if invalid_chars: - invalid_list = ", ".join(sorted(set(invalid_chars))) - return False, f"Invalid amino acid(s): {invalid_list}", None - - return True, "", clean_sequence - - except Exception as e: - return False, f"Error validating sequence: {str(e)}", None - -def validate_oligonucleotide_sequence(sequence_str: str) -> Tuple[bool, str, Optional[str]]: - """Validate an oligonucleotide (RNA) sequence - - Args: - sequence_str (str): The nucleotide sequence - - Returns: - Tuple[bool, str, Optional[str]]: (is_valid, error_message, sequence_str) - """ - try: - # Clean the sequence - sequence_str = sequence_str.strip().upper() - if not sequence_str: - return False, "Sequence cannot be empty", None - - # Remove common formatting characters (spaces, numbers, newlines) - clean_sequence = re.sub(r'[^ACGU]', '', sequence_str) - - if not clean_sequence: - return False, "No valid nucleotide letters found", None - - # Validate nucleotides (A, C, G, U for RNA) - valid_nucleotides = set("ACGU") - invalid_chars = [nt for nt in clean_sequence if nt not in valid_nucleotides] - - if invalid_chars: - invalid_list = ", ".join(sorted(set(invalid_chars))) - return False, f"Invalid nucleotide(s): {invalid_list}. Valid nucleotides: A, C, G, U", None - - return True, "", sequence_str - - except Exception as e: - return False, f"Error validating oligonucleotide sequence: {str(e)}", None - -def generate_isotope_pattern_from_formula(formula_str: str, use_fine_generator: bool = False) -> Dict[str, Any]: - """Generate isotope pattern from elemental formula using specified generator. - - Args: - formula_str (str): The elemental formula string - use_fine_generator (bool): Whether to use FineIsotopePatternGenerator (default: False) - - Returns: - Dict[str, Any]: Results dictionary with mzs, intensities, and metadata - """ - try: - # Validate formula - is_valid, error_msg, empirical_formula = validate_elemental_formula(formula_str) - if not is_valid: - return {"success": False, "error": error_msg} - - # Select generator - generator = fine_pattern_generator if use_fine_generator else coarse_pattern_generator - generator_name = "Fine" if use_fine_generator else "Coarse" - - # Generate isotope pattern - isotope_distribution = empirical_formula.getIsotopeDistribution(generator) - avg_weight = empirical_formula.getAverageWeight() - distribution = isotope_distribution.getContainer() - - # Extract data - mzs = np.array([p.getMZ() for p in distribution]) - intensities = np.array([p.getIntensity() for p in distribution]) - - # Calculate masses - monoisotopic_mass = empirical_formula.getMonoWeight() - average_mass = empirical_formula.getAverageWeight() - - return { - "success": True, - "mzs": mzs, - "intensities": intensities, - "monoisotopic_mass": monoisotopic_mass, - "average_mass": average_mass, - "formula": formula_str, - "source_type": f"Elemental Formula ({generator_name})", - "input_value": formula_str, - "generator": generator_name - } - - except Exception as e: - return {"success": False, "error": f"Error generating pattern from formula: {str(e)}"} - -def generate_isotope_pattern_from_sequence(sequence_str: str, use_fine_generator: bool = False) -> Dict[str, Any]: - """Generate isotope pattern from peptide/protein sequence using specified generator. - - Args: - sequence_str (str): The amino acid sequence - use_fine_generator (bool): Whether to use FineIsotopePatternGenerator (default: False) - - Returns: - Dict[str, Any]: Results dictionary with mzs, intensities, and metadata - """ - try: - # Validate sequence - is_valid, error_msg, clean_sequence = validate_peptide_sequence(sequence_str) - if not is_valid: - return {"success": False, "error": error_msg} - - # Create AASequence object - aa_sequence = oms.AASequence.fromString(clean_sequence) - - # Get empirical formula from sequence - empirical_formula = aa_sequence.getFormula() - - # Select generator - generator = fine_pattern_generator if use_fine_generator else coarse_pattern_generator - generator_name = "Fine" if use_fine_generator else "Coarse" - - # Generate isotope pattern - isotope_distribution = empirical_formula.getIsotopeDistribution(generator) - avg_weight = aa_sequence.getAverageWeight() - - distribution = isotope_distribution.getContainer() - - # Extract data - mzs = np.array([p.getMZ() for p in distribution]) - intensities = np.array([p.getIntensity() for p in distribution]) - - # Calculate masses - monoisotopic_mass = aa_sequence.getMonoWeight() - average_mass = aa_sequence.getAverageWeight() - - # Handle formula string conversion (pyOpenMS version compatibility) - formula_str = empirical_formula.toString() - if isinstance(formula_str, bytes): - formula_str = formula_str.decode('utf-8') - - return { - "success": True, - "mzs": mzs, - "intensities": intensities, - "monoisotopic_mass": monoisotopic_mass, - "average_mass": average_mass, - "formula": formula_str, - "sequence": clean_sequence, - "source_type": f"Peptide/Protein Sequence ({generator_name})", - "input_value": sequence_str, - "generator": generator_name - } - - except Exception as e: - return {"success": False, "error": f"Error generating pattern from sequence: {str(e)}"} - -def generate_isotope_pattern_from_oligonucleotide(sequence_str: str, use_fine_generator: bool = False) -> Dict[str, Any]: - """Generate isotope pattern from oligonucleotide (DNA/RNA) sequence using specified generator. - - Args: - sequence_str (str): The nucleotide sequence (DNA will be converted to RNA) - use_fine_generator (bool): Whether to use FineIsotopePatternGenerator (default: False) - - Returns: - Dict[str, Any]: Results dictionary with mzs, intensities, and metadata - """ - try: - # Validate sequence (converts DNA to RNA automatically) - is_valid, error_msg, rna_sequence = validate_oligonucleotide_sequence(sequence_str) - if not is_valid: - return {"success": False, "error": error_msg} - - # Check if conversion happened - original_clean = re.sub(r'[^ACGTUN]', '', sequence_str.strip().upper()) - conversion_note = "" - if 'T' in original_clean: - conversion_note = " (DNA converted to RNA: T→U)" - - # Create NASequence object (for nucleic acids - RNA only) - na_sequence = oms.NASequence.fromString(rna_sequence) - - # Get empirical formula from sequence - empirical_formula = na_sequence.getFormula() - - # Select generator - generator = fine_pattern_generator if use_fine_generator else coarse_pattern_generator - generator_name = "Fine" if use_fine_generator else "Coarse" - - # Generate isotope pattern - isotope_distribution = empirical_formula.getIsotopeDistribution(generator) - avg_weight = na_sequence.getAverageWeight() - - distribution = isotope_distribution.getContainer() - - # Extract data - mzs = np.array([p.getMZ() for p in distribution]) - intensities = np.array([p.getIntensity() for p in distribution]) - - # Calculate masses - monoisotopic_mass = na_sequence.getMonoWeight() - average_mass = na_sequence.getAverageWeight() - - # Handle formula string conversion (pyOpenMS version compatibility) - formula_str = empirical_formula.toString() - if isinstance(formula_str, bytes): - formula_str = formula_str.decode('utf-8') - - return { - "success": True, - "mzs": mzs, - "intensities": intensities, - "monoisotopic_mass": monoisotopic_mass, - "average_mass": average_mass, - "formula": formula_str, - "sequence": rna_sequence, - "original_sequence": original_clean, - "conversion_note": conversion_note, - "source_type": f"Oligonucleotide Sequence ({generator_name}){conversion_note}", - "input_value": sequence_str, - "generator": generator_name - } - - except Exception as e: - return {"success": False, "error": f"Error generating pattern from oligonucleotide: {str(e)}"} - -def generate_isotope_pattern_from_mass(target_mass: float) -> Dict[str, Any]: - """Generate isotope pattern from mass using CoarseIsotopePatternGenerator (existing method). - - Args: - target_mass (float): The target mass in Da - - Returns: - Dict[str, Any]: Results dictionary with mzs, intensities, and metadata - """ - try: - if target_mass <= 0: - return {"success": False, "error": "Mass must be greater than 0"} - - # Start with most_intense_mass == avg_mass (existing algorithm) - start = coarse_pattern_generator.estimateFromPeptideWeight(target_mass).getMostAbundant().getMZ() - - # Extend to the right - right_samples = [] - right_samples_avg = [] - for delta in np.arange(0, 20, 0.2): - current_sample = coarse_pattern_generator.estimateFromPeptideWeight( - target_mass + delta - ).getMostAbundant().getMZ() - right_samples.append(current_sample) - right_samples_avg.append(target_mass + delta) - - # Stop extension if result gets worse than base case - if abs(current_sample - target_mass) > abs(start - target_mass): - break - - # Extend to the left - left_samples = [] - left_samples_avg = [] - for delta in np.arange(0, 20, 0.2): - current_sample = coarse_pattern_generator.estimateFromPeptideWeight( - target_mass - delta - ).getMostAbundant().getMZ() - left_samples.append(current_sample) - left_samples_avg.append(target_mass - delta) - - # Stop extension if result gets worse than base case - if abs(current_sample - target_mass) > abs(start - target_mass): - break - - # Combine samples - samples = np.array(left_samples + [start] + right_samples) - samples_avg = np.array(left_samples_avg + [target_mass] + right_samples_avg) - - # Determine best fit - best_pos = np.argmin(np.abs(samples - target_mass)) - best_avg = samples_avg[best_pos] - - # Compute distribution of best fit - distribution_obj = coarse_pattern_generator.estimateFromPeptideWeight(best_avg) - distribution = distribution_obj.getContainer() - mzs = np.array([p.getMZ() for p in distribution]) - intensities = np.array([p.getIntensity() for p in distribution]) - monoisotopic = np.min(mzs) # Monoisotopic isotope = lightest - - # Recompute average - best_avg = np.sum(mzs * intensities) - - # Adjust distribution - delta = distribution_obj.getMostAbundant().getMZ() - target_mass - mzs -= delta - best_avg -= delta - monoisotopic -= delta - - return { - "success": True, - "mzs": mzs, - "intensities": intensities, - "monoisotopic_mass": monoisotopic, - "average_mass": best_avg, - "formula": "Estimated from mass", - "source_type": "Mass Estimation", - "input_value": f"{target_mass:.2f} Da" - } - - except Exception as e: - return {"success": False, "error": f"Error generating pattern from mass: {str(e)}"} - -def create_isotope_plot(result_data: Dict[str, Any]) -> go.Figure: - """Create the isotope pattern plot. - - Args: - result_data (Dict[str, Any]): Results from pattern generation - - Returns: - go.Figure: Plotly figure object - """ - mzs = result_data["mzs"] - intensities = result_data["intensities"] - - # Create dataframe - df = pd.DataFrame({ - 'mz': mzs, - 'intensity': intensities - }) - - # Color highlights - df['color'] = 'black' - df.iloc[np.argmax(df['intensity']), -1] = 'red' - - # Plot - fig = go.Figure() - fig = df[df['intensity'] != 0].plot( - x="mz", - y="intensity", - kind="spectrum", - peak_color='color', - canvas=fig, - show_plot=False, - grid=False, - annotate_top_n_peaks=1 - ) - - considered = mzs[intensities > (0.001 * max(intensities))] - fig.update_xaxes(range=[np.min(considered), np.max(considered)]) - fig.update_layout( - title="Isotopic Envelope", - xaxis_title="m/z", - yaxis_title="Intensity" - ) - - return fig - -# UI Implementation -st.title("📶 Isotopic Pattern Calculator") - -st.markdown(""" -**Generate theoretical isotopic envelopes** for molecules to understand mass spectrometric signatures and optimize analysis conditions. - -This tool calculates isotopic distributions using pyOpenMS, helping you: -- **Predict MS peak patterns** for accurate mass measurements and peak assignment -- **Optimize MS parameters** by understanding peak spacing and intensity distributions -- **Validate experimental data** by comparing observed vs theoretical patterns -- **Design targeted experiments** by predicting isotopic signatures for specific molecules -""") - -with st.expander("📚 **Understanding Isotopic Patterns**"): - st.markdown(""" - **Natural Isotopes:** - - Elements exist as multiple isotopes with different masses - - **Carbon**: ¹²C (98.9%) and ¹³C (1.1%) - primary contributor to isotopic patterns - - **Nitrogen**: ¹⁴N (99.6%) and ¹⁵N (0.4%) - important for peptides and nucleotides - - **Sulfur**: ³²S (95.0%) and ³⁴S (4.2%) - significant contribution in proteins - - **Isotopic Envelope Shape:** - - **Small molecules**: Simple patterns with M+1, M+2 peaks - - **Large molecules**: Complex bell-shaped distributions - - **Pattern width** increases with molecular size due to multiple isotopic combinations - - **Input Methods:** - - **Mass Estimation**: Quick approximation for unknown compounds - - **Elemental Formula**: Precise calculation for known molecular composition - - **Peptide/Protein**: Automatic formula calculation from amino acid sequence - - **Oligonucleotides**: DNA/RNA sequence support with automatic T→U conversion - - **Generator Options:** - - **Coarse Generator**: Fast computation, suitable for most applications - - **Fine Generator**: High precision for detailed isotopic analysis - - **Applications:** - - **Peak assignment** in high-resolution mass spectrometry - - **Charge state determination** through isotopic peak spacing - - **Molecular formula confirmation** by pattern matching - - **Method development** for accurate mass measurements - """) - -st.markdown(""" -**Choose your input method:** -""") - -# Input method selection -input_method = st.selectbox( - "Select Input Method:", - ["Mass (Da)", "Elemental Formula", "Peptide/Protein Sequence", "Oligonucleotide Sequence"], - help="Choose how you want to specify your molecule" -) - -# Generator selection (only for formula, sequence, and oligonucleotide) -if input_method in ["Elemental Formula", "Peptide/Protein Sequence", "Oligonucleotide Sequence"]: - use_fine_generator = st.checkbox( - "Use Fine Isotope Pattern Generator", - value=False, - help=""" - - **Coarse Generator** (Default): Faster computation, good for most applications - - **Fine Generator**: More precise calculations, slower for large molecules - """ - ) -else: - use_fine_generator = False - -col1, col2 = st.columns([1, 1]) - -with col1: - result_data = None - - if input_method == "Mass (Da)": - target_mass = st.number_input( - "Input most abundant/intense peak [Da]:", - min_value=0.0, - value=20000.0, - help=""" - The most intense (or most abundant) peak is the isotope peak - with the highest abundance in the protein's mass spectrum. It - represents the most common isotopic composition and serves as - the reference point for reconstructing the full isotopic envelope. - """ - ) - - if st.button('Compute Isotopic Envelope'): - with st.spinner('Computing from mass...'): - result_data = generate_isotope_pattern_from_mass(target_mass) - - elif input_method == "Elemental Formula": - formula_input = st.text_input( - "Elemental Formula:", - value="C100H150N26O30S1", - help=""" - Enter the molecular formula using standard notation. - Examples: C100H150N26O30S1, C6H12O6, C43H66N12O12S2 - """ - ) - - if st.button('Compute Isotopic Envelope'): - generator_type = "fine" if use_fine_generator else "coarse" - with st.spinner(f'Computing from formula using {generator_type} generator...'): - result_data = generate_isotope_pattern_from_formula(formula_input, use_fine_generator) - - elif input_method == "Peptide/Protein Sequence": - sequence_input = st.text_area( - "Amino Acid Sequence:", - value="PEPTIDE", - height=100, - help=""" - Enter the peptide or protein sequence using single-letter amino acid codes. - Examples: PEPTIDE, MKLNFSLRLRR, ACDEFGHIKLMNPQRSTVWY - """ - ) - - if st.button('Compute Isotopic Envelope'): - generator_type = "fine" if use_fine_generator else "coarse" - with st.spinner(f'Computing from sequence using {generator_type} generator...'): - result_data = generate_isotope_pattern_from_sequence(sequence_input, use_fine_generator) - - elif input_method == "Oligonucleotide Sequence": - oligonucleotide_input = st.text_area( - "Nucleotide Sequence:", - value="AUCGAUCG", - height=100, - help=""" - RNA sequence using standard nucleotide codes. - Valid nucleotides: A (adenine), C (cytosine), G (guanine), U (uracil), N (any) - Examples: AUCGAUCG, AAAUUUCCCGGG - """ - ) - - if st.button('Compute Isotopic Envelope'): - generator_type = "fine" if use_fine_generator else "coarse" - with st.spinner(f'Computing from oligonucleotide using {generator_type} generator...'): - result_data = generate_isotope_pattern_from_oligonucleotide(oligonucleotide_input, use_fine_generator) - -with col2: - if result_data: - if result_data["success"]: - # Display results - st.write(f"**Source:** {result_data['source_type']}") - st.write(f"**Input:** {result_data['input_value']}") - if "generator" in result_data: - st.write(f"**Generator:** {result_data['generator']} Isotope Pattern Generator") - if "formula" in result_data: - st.write(f"**Molecular Formula:** {result_data['formula']}") - if "sequence" in result_data: - st.write(f"**Sequence:** {result_data['sequence']}") - # Show conversion info for oligonucleotides - if "original_sequence" in result_data and "conversion_note" in result_data: - if result_data["conversion_note"]: - st.write(f"**Original Sequence:** {result_data['original_sequence']}") - st.info(f"DNA sequence converted to RNA for processing{result_data['conversion_note']}") - st.write(f"**Monoisotopic Mass:** {result_data['monoisotopic_mass']:.5f} Da") - st.write(f"**Average Mass:** {result_data['average_mass']:.5f} Da") - else: - st.error(f"Error: {result_data['error']}") - -# Display plot and download options -if result_data and result_data["success"]: - # Create and display plot - fig = create_isotope_plot(result_data) - show_fig(fig, 'Isotopic Envelope') - - # Prepare download data - df_out = pd.DataFrame({ - 'mz': result_data["mzs"], - 'intensity': result_data["intensities"], - 'color': ['red' if i == np.argmax(result_data["intensities"]) else 'black' - for i in range(len(result_data["mzs"]))] - }) - - # Create download files - tsv_buffer = io.StringIO() - df_out.to_csv(tsv_buffer, sep='\t', index=False) - tsv_buffer.seek(0) - tsv_file = tsv_buffer.getvalue() - - xlsx_buffer = io.BytesIO() - with pd.ExcelWriter(xlsx_buffer, engine="xlsxwriter") as writer: - df_out.to_excel(writer, index=False, sheet_name="MS Data") - xlsx_buffer.seek(0) - xlsx_file = xlsx_buffer.getvalue() - - # Download buttons - tsv_col, excel_col, _ = st.columns(3) - - @st.fragment - def tsv_download(): - st.download_button( - label="Download TSV file", - file_name=f'Isotopic_Envelope_{result_data["source_type"].replace("/", "_").replace(" ", "_")}.tsv', - data=tsv_file - ) - - with tsv_col: - tsv_download() - - @st.fragment - def xlsx_download(): - st.download_button( - label="Download Excel file", - file_name=f'Isotopic_Envelope_{result_data["source_type"].replace("/", "_").replace(" ", "_")}.xlsx', - data=xlsx_file - ) - - with excel_col: - xlsx_download() \ No newline at end of file diff --git a/content/peptide_mz_calculator.py b/content/peptide_mz_calculator.py deleted file mode 100644 index 92275d3..0000000 --- a/content/peptide_mz_calculator.py +++ /dev/null @@ -1,247 +0,0 @@ -""" -Peptide m/z Calculator App. -""" - -import streamlit as st -import pandas as pd -from pathlib import Path - -from src.common.common import page_setup, v_space - -# Import backend functions -from src.peptide_mz_calculator import ( - calculate_peptide_mz_range, - validate_sequence, -) - -# Page setup -page_setup(page="main") - -# Hero section & logo -col1, col2, col3 = st.columns([0.5, 2, 1]) -with col2: - st.markdown( - """ -
-

⚖️ Peptide m/z Calculator

-

- Calculate theoretical mass-to-charge ratios (m/z) for peptides with and without modifications. -

-
- """, - unsafe_allow_html=True, - ) - -# Description -st.markdown( - """ -**Calculate precise theoretical m/z values** for peptides. - -""" -) - -# Expandable help sections -with st.expander("📚 **Sequence Format**"): - st.markdown(""" - - **💡 Format Tips:** - - Use parentheses for modifications: `(Oxidation)`, `(Carbamidomethyl)` - - Use dots for terminal modifications: `.(Acetyl)`, `(Amidated).` - - Use square brackets for mass deltas: `[+15.995]`, `[-18.010]` - - **Examples:** - - `PEPTIDE`: Basic amino acid sequence - - `M(Oxidation)PEPTIDE`: Methionine oxidation modification - - `C(Carbamidomethyl)PEPTIDE`: Carbamidomethyl cysteine modification - - `.(Acetyl)PEPTIDE`: N-terminal acetylation - - `PEPTIDE(Amidated).`: C-terminal amidation - - `PEPTIDE[+15.995]`: Mass delta modification - - `M[+15.994915]PEPTIDE`: Specific mass delta on methionine - - `ALSSC(UNIMOD:4)VVDEEQDVER`: UNIMOD modification notation - - `PEPS(Phospho)TIDE`: Phosphorylation modification - - `.(Acetyl)M(Oxidation)PEPTIDE`: Multiple modifications - - - **Supported Amino Acids:** - Standard 20 amino acids (A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, V) plus X (any) and U (selenocysteine) - - - **Common static modifications:** - - | Name | Target Residue(s) | Mass Shift (Da) | Description | - |------|------------------|-----------------|-------------| - | Carbamidomethyl | C | +57.021464 | Carbamidomethylation of cysteine | - - - **Common dynamic modifications (for more see UniMod names):** - - | Name | Target Residue(s) | Mass Shift (Da) | Description | - |------|------------------|-----------------|-------------| - | Oxidation | M | +15.994915 | Oxidation of methionine | - | Deamidated | N, Q | +0.984016 | Spontaneous deamidation | - | Phospho | S, T, Y | +79.966331 | Phosphorylation on STY | - | Acetyl | Protein N-term | +42.010565 | N-terminal acetylation | - | Gln->pyro-Glu | N-term Q | -17.026549 | Cyclization of glutamine | - | Glu->pyro-Glu | N-term E | -18.010565 | Cyclization of glutamic acid | - | Formyl | N-term | +27.994915 | Formylation of N-terminus | - | Methyl | K, R, H | +14.015650 | Single methyl group addition | - | Dimethyl | K, R | +28.031300 | Two methyl groups | - | Sulfo | Y | +79.956815 | Sulfation on tyrosine | - | GG (diglycyl) | K | +114.042927 | Ubiquitin remnant on lysine after trypsin digest | - - """) - - - -st.markdown("---") - -# Input section -col1_input, col2_input = st.columns([3, 1]) - -with col1_input: - # Sequence input - sequence_input = st.text_input( - "Peptide Sequence", - value="M(Oxidation)PEPTIDE", - help="""Enter peptide sequence in AASequence format. Examples: - • PEPTIDE - Basic sequence - • M(Oxidation)PEPTIDE - Oxidized methionine - • C(Carbamidomethyl)PEPTIDE - Carbamidomethyl cysteine - • .(Acetyl)PEPTIDE - N-terminal acetylation""", - placeholder="e.g., M(Oxidation)PEPTIDE, C(Carbamidomethyl)PEPTIDE", - ) - -with col2_input: - # Charge range inputs - - default_charge = 2 - - charge_col1, charge_col2 = st.columns(2) - with charge_col1: - min_charge = st.number_input( - "Min Charge", - min_value=1, - max_value=20, - value=default_charge, - step=1 - ) - with charge_col2: - max_charge = st.number_input( - "Max Charge", - min_value=1, - max_value=200, - value=min(default_charge + 2, 6), - step=1 - ) - - # Ensure valid range - if min_charge > max_charge: - st.error("Min charge must be ≤ Max charge") - min_charge = max_charge - -# Calculate button -calculate_btn = st.button( - "🧮 Calculate m/z", - type="primary", - use_container_width=True -) - -st.markdown("---") - -# Results section -if calculate_btn: - if not sequence_input.strip(): - st.error("Please enter a peptide sequence.") - else: - # Validate sequence - is_valid, error_msg = validate_sequence(sequence_input) - - if not is_valid: - st.error(f"Invalid sequence: {error_msg}") - else: - try: - with st.spinner("Calculating m/z ratios..."): - results = calculate_peptide_mz_range( - sequence_input, - (min_charge, max_charge) - ) - - st.success("✅ Calculation Complete!") - - # Results display - result_col1, result_col2 = st.columns(2) - - with result_col1: - st.markdown("### 📊 m/z Results") - - charge_results = results.get("charge_results", {}) - charge_states = sorted(charge_results.keys()) - - # Display results - if len(charge_states) <= 5: - # Simple list for few charge states - for charge in charge_states: - charge_data = charge_results[charge] - mz_value = charge_data['mz_ratio'] - st.markdown(f"**Charge +{charge}:** {mz_value:.6f}") - else: - # Table for many charge states - table_data = [] - for charge in charge_states: - charge_data = charge_results[charge] - table_data.append({ - "Charge": f"+{charge}", - "m/z": f"{charge_data['mz_ratio']:.6f}" - }) - - df = pd.DataFrame(table_data) - st.dataframe(df, use_container_width=True, hide_index=True) - - st.markdown(f"**Monoisotopic Mass:** {results['monoisotopic_mass']:.6f} Da") - - with result_col2: - st.markdown("### 🧪 Sequence Information") - st.markdown(f"**Input Sequence:** {sequence_input}") - st.markdown(f"**Molecular Formula:** {results['molecular_formula']}") - st.markdown(f"**Length:** {results['sequence_length']} amino acids") - - # Additional details - with st.expander("📋 Additional Details"): - # Amino acid composition - aa_composition = results["aa_composition"] - if aa_composition: - st.markdown("**Amino Acid Composition:**") - composition_text = ", ".join([ - f"{aa}: {count}" - for aa, count in sorted(aa_composition.items()) - ]) - st.markdown(composition_text) - - except Exception as e: - st.error(f"Calculation error: {str(e)}") - - st.markdown(""" - **Common Issues:** - - Use correct AASequence format: `M(Oxidation)PEPTIDE` - - Check modification names: `(Carbamidomethyl)`, `(Oxidation)` - - Verify amino acid codes (standard 20 + X, U) - - Use dots for terminal mods: `.(Acetyl)PEPTIDE` - """) - -# About section -st.markdown("---") -with st.expander("ℹ️ **About This Peptide m/z Calculator**"): - st.markdown(""" - **AASequence Format Support:** - - Uses PyOpenMS `AASequence.fromString()` directly - - No complex parsing or format conversion - - Native support for modifications and charge notation - - Standardized output format - - **Supported Amino Acids:** - Standard 20 amino acids (A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, V) plus X (any) and U (selenocysteine) - - **Modification Format:** - - Named modifications: `(Oxidation)`, `(Carbamidomethyl)`, `(Phospho)` - - Terminal modifications: `.(Acetyl)PEPTIDE`, `PEPTIDE(Amidated).` - - Mass deltas: `[+15.994915]`, `[-18.010565]` - - UNIMOD notation: `[UNIMOD:4]`, `[UNIMOD:35]` - - """) diff --git a/content/raw_data_viewer.py b/content/raw_data_viewer.py deleted file mode 100644 index d788e25..0000000 --- a/content/raw_data_viewer.py +++ /dev/null @@ -1,44 +0,0 @@ -from pathlib import Path - -import streamlit as st - -from src.common.common import page_setup -from src import view - - -params = page_setup() - -st.title("View raw MS data") - -# File selection can not be in fragment since it influences the subsequent sections -cols = st.columns(3) - -mzML_dir = Path(st.session_state.workspace, "mzML-files") -file_options = [f.name for f in mzML_dir.iterdir() if "external_files.txt" not in f.name] - -# Check if local files are available -external_files = Path(mzML_dir, "external_files.txt") -if external_files.exists(): - with open(external_files, "r") as f_handle: - external_files = f_handle.readlines() - external_files = [f.strip() for f in external_files] - file_options += external_files - -selected_file = cols[0].selectbox( - "choose file", - file_options, - key="view_selected_file" -) -if selected_file: - view.get_df(Path(st.session_state.workspace, "mzML-files", selected_file)) - - - tabs = st.tabs( - ["📈 Peak map (MS1)", "📈 Spectra (MS1 + MS2)", "📈 Chromatograms (MS1)"] - ) - with tabs[0]: - view.view_peak_map() - with tabs[1]: - view.view_spectrum() - with tabs[2]: - view.view_bpc_tic() diff --git a/content/run_example_workflow.py b/content/run_example_workflow.py deleted file mode 100644 index 49e70e9..0000000 --- a/content/run_example_workflow.py +++ /dev/null @@ -1,59 +0,0 @@ -import streamlit as st - -from pathlib import Path - -from src.common.common import page_setup, save_params -from src import mzmlfileworkflow - -# Page name "workflow" will show mzML file selector in sidebar -params = page_setup() - -st.title("Workflow") -st.markdown( - """ -More complex workflow with mzML files and input form. - -Changing widgets within the form will not trigger the execution of the script immediatly. -This is great for large parameter sections. -""" -) - -with st.form("workflow-with-mzML-form"): - st.markdown("**Parameters**") - - file_options = [f.stem for f in Path(st.session_state.workspace, "mzML-files").glob("*.mzML") if "external_files.txt" not in f.name] - - # Check if local files are available - external_files = Path(Path(st.session_state.workspace, "mzML-files"), "external_files.txt") - if external_files.exists(): - with open(external_files, "r") as f_handle: - external_files = f_handle.readlines() - external_files = [str(Path(f.strip()).with_suffix('')) for f in external_files] - file_options += external_files - - st.multiselect( - "**input mzML files**", - file_options, - params["example-workflow-selected-mzML-files"], - key="example-workflow-selected-mzML-files", - ) - - c1, _, c3 = st.columns(3) - if c1.form_submit_button( - "Save Parameters", help="Save changes made to parameter section." - ): - params = save_params(params) - run_workflow_button = c3.form_submit_button("Run Workflow", type="primary") - -result_dir = Path(st.session_state["workspace"], "mzML-workflow-results") - -if run_workflow_button: - params = save_params(params) - if params["example-workflow-selected-mzML-files"]: - mzmlfileworkflow.run_workflow(params, result_dir) - else: - st.warning("Select some mzML files.") - - - -mzmlfileworkflow.result_section(result_dir) \ No newline at end of file diff --git a/content/run_subprocess.py b/content/run_subprocess.py deleted file mode 100644 index 8aebfa7..0000000 --- a/content/run_subprocess.py +++ /dev/null @@ -1,89 +0,0 @@ -import streamlit as st -import threading -import os - -from pathlib import Path - -from src.common.common import page_setup, save_params -from src.run_subprocess import run_subprocess - -# Page name "workflow" will show mzML file selector in sidebar -params = page_setup() - -st.title("Run subprocess") -st.markdown( - """ - This example demonstrates how to run an external process (in this case, the Linux command 'grep' or 'findstr' for windows) as a subprocess to extract IDs from the selected mzML file while displaying the process output. - It also works with longer-running processes, such as calling an OpenMS TOPP tool. - """ -) - -# Define the directory where mzML files are located -mzML_dir: Path = Path(st.session_state.workspace, "mzML-files") - -# Create two columns for the Streamlit app layout -col1, col2 = st.columns(2) - -# Use the `glob` method to get a list of all files in the directory -file_list = list(mzML_dir.glob("*")) - -# select box to select file from user -file_name = st.selectbox("**Please select file**", [file.stem for file in file_list]) - -# full path of file -mzML_file_path = os.path.join(mzML_dir, str(file_name) + ".mzML") - -# Create a dictionary to capture the output and status of the subprocess -result_dict = {} -result_dict["success"] = False -result_dict["log"] = " " - -# Create a flag to terminate the subprocess -terminate_flag = threading.Event() -terminate_flag.set() - - -# Function to terminate the subprocess -def terminate_subprocess(): - """Set flag to terminate subprocess.""" - global terminate_flag - terminate_flag.set() - - -# Check if the "Extract ids" button is clicked -if st.button("Extract ids"): - # Check if the "Terminate/Clear" button is clicked to stop the subprocess and clear the form - if st.button("Terminate/Clear"): - # Terminate the subprocess - terminate_subprocess() - st.warning("Process terminated. The analysis may not be complete.") - # Reset the page - st.rerun() - - # Display a status message while running the analysis - with st.status("Please wait until fetching all ids from mzML 😑"): - - # Define the command to run as a subprocess (example: grep or findstr (for windows)) - # 'nt' indicates Windows - if os.name == 'nt': - args = ["findstr", "idRef", mzML_file_path] - else: - # Assume 'posix' for Linux and macOS - args =["grep", "idRef", mzML_file_path] - - # Display the command that will be executed - message = f"Running command: {' '.join(args)}" - st.code(message) - - # Run the subprocess command - run_subprocess(args, result_dict) - - # Check if the subprocess was successful - if result_dict["success"]: - # Here can add code here to handle the results, e.g., display them to the user - - pass # Placeholder for result handling - - -# At the end of each page, always save parameters (including any changes via widgets with key) -save_params(params) diff --git a/content/simple_workflow.py b/content/simple_workflow.py deleted file mode 100644 index 130dd43..0000000 --- a/content/simple_workflow.py +++ /dev/null @@ -1,45 +0,0 @@ -import streamlit as st - -from src.common.common import page_setup, save_params, show_table -from src import simpleworkflow - -# Page name "workflow" will show mzML file selector in sidebar -params = page_setup() - -st.title("Simple Workflow") -st.markdown("Example for a simple workflow with quick execution times.") - -# Define two widgets with values from paramter file -# To save them as parameters use the same key as in the json file - -# We access the x-dimension via local variable -xdimension = st.number_input( - label="x dimension", - min_value=1, - max_value=20, - value=params["example-x-dimension"], - step=1, - key="example-x-dimension", -) - -st.number_input( - label="y dimension", - min_value=1, - max_value=20, - value=params["example-y-dimension"], - step=1, - key="example-y-dimension", -) - -# Get a dataframe with x and y dimensions via time consuming (sleep) cached function -# If the input has been given before, the function does not run again -# Input x from local variable, input y from session state via key -df = simpleworkflow.generate_random_table( - xdimension, st.session_state["example-y-dimension"] -) - -# Display dataframe via custom show_table function, which will render a download button as well -show_table(df, download_name="random-table") - -# At the end of each page, always save parameters (including any changes via widgets with key) -save_params(params) diff --git a/content/topp_workflow_execution.py b/content/topp_workflow_execution.py deleted file mode 100644 index 2248d00..0000000 --- a/content/topp_workflow_execution.py +++ /dev/null @@ -1,12 +0,0 @@ -import streamlit as st -from src.common.common import page_setup -from src.Workflow import Workflow - - -params = page_setup() - -wf = Workflow() - -wf.show_execution_section() - - diff --git a/content/topp_workflow_file_upload.py b/content/topp_workflow_file_upload.py deleted file mode 100644 index ec58e2f..0000000 --- a/content/topp_workflow_file_upload.py +++ /dev/null @@ -1,11 +0,0 @@ -import streamlit as st -from src.common.common import page_setup -from src.Workflow import Workflow - - -params = page_setup() - -wf = Workflow() - -wf.show_file_upload_section() - diff --git a/content/topp_workflow_parameter.py b/content/topp_workflow_parameter.py deleted file mode 100644 index 26a602d..0000000 --- a/content/topp_workflow_parameter.py +++ /dev/null @@ -1,10 +0,0 @@ -import streamlit as st -from src.common.common import page_setup -from src.Workflow import Workflow - - -params = page_setup() - -wf = Workflow() - -wf.show_parameter_section() diff --git a/content/topp_workflow_results.py b/content/topp_workflow_results.py deleted file mode 100644 index d6db8b5..0000000 --- a/content/topp_workflow_results.py +++ /dev/null @@ -1,10 +0,0 @@ -import streamlit as st -from src.common.common import page_setup -from src.Workflow import Workflow - - -params = page_setup() - -wf = Workflow() - -wf.show_results_section() \ No newline at end of file diff --git a/test.py b/test.py index 8a2a3ad..c392332 100644 --- a/test.py +++ b/test.py @@ -1,24 +1,56 @@ -# test_my_math.py import unittest -from urllib.request import urlretrieve +import ast +import json +from pathlib import Path -from src.simpleworkflow import generate_random_table -from src.mzmlfileworkflow import mzML_file_get_num_spectra -from pathlib import Path +def get_pages_from_app(): + """Parse app.py AST to extract page paths from st.Page(Path(...)) calls.""" + tree = ast.parse(Path("app.py").read_text(encoding="utf-8")) + pages = [] + for node in ast.walk(tree): + # Match st.Page(Path("content", "filename.py"), ...) + if ( + isinstance(node, ast.Call) + and isinstance(node.func, ast.Attribute) + and node.func.attr == "Page" + and node.args + and isinstance(node.args[0], ast.Call) + and isinstance(node.args[0].func, ast.Name) + and node.args[0].func.id == "Path" + ): + parts = [ + arg.value + for arg in node.args[0].args + if isinstance(arg, ast.Constant) and isinstance(arg.value, str) + ] + if parts: + pages.append(str(Path(*parts))) + return pages + + +class TestSettingsJson(unittest.TestCase): + def test_settings_json_exists(self): + self.assertTrue(Path("settings.json").exists(), "settings.json file is missing") + + def test_settings_json_valid(self): + with open("settings.json", "r") as f: + settings = json.load(f) + self.assertIn("app-name", settings) + self.assertIn("version", settings) + + +class TestContentPagesExist(unittest.TestCase): + def test_all_content_pages_exist(self): + """Test that all content pages referenced by app.py exist.""" + pages = get_pages_from_app() + self.assertTrue( + len(pages) > 0, + "No pages found in app.py — ensure app.py contains st.Page(Path(...)) calls", + ) + for page in pages: + self.assertTrue(Path(page).exists(), f"Content page {page} is missing") -class TestSimpleWorkflow(unittest.TestCase): - def test_workflow(self): - result = generate_random_table(2, 3).shape - self.assertEqual(result, (2,3), "Expected dataframe shape.") - -class TestComplexWorkflow(unittest.TestCase): - def test_workflow(self): - # load data from url - urlretrieve("https://raw.githubusercontent.com/OpenMS/streamlit-template/main/example-data/mzML/Treatment.mzML", "testfile.mzML") - result = mzML_file_get_num_spectra("testfile.mzML") - Path("testfile.mzML").unlink() - self.assertEqual(result, 786, "Expected dataframe shape.") if __name__ == '__main__': unittest.main() diff --git a/test_gui.py b/test_gui.py index 101865c..fa699ea 100644 --- a/test_gui.py +++ b/test_gui.py @@ -1,134 +1,66 @@ +import ast +from pathlib import Path from streamlit.testing.v1 import AppTest import pytest -from src import fileupload import json -from pathlib import Path -import shutil + + +def get_pages_from_app(): + """Parse app.py AST to extract page paths from st.Page(Path(...)) calls.""" + tree = ast.parse(Path("app.py").read_text(encoding="utf-8")) + pages = [] + for node in ast.walk(tree): + if ( + isinstance(node, ast.Call) + and isinstance(node.func, ast.Attribute) + and node.func.attr == "Page" + and node.args + and isinstance(node.args[0], ast.Call) + and isinstance(node.args[0].func, ast.Name) + and node.args[0].func.id == "Path" + ): + parts = [ + arg.value + for arg in node.args[0].args + if isinstance(arg, ast.Constant) and isinstance(arg.value, str) + ] + if parts: + pages.append(str(Path(*parts))) + return pages + + +def _uses_page_link(path: str) -> bool: + """Return True if the file calls st.page_link(), which is incompatible with AppTest.""" + return "st.page_link(" in Path(path).read_text(encoding="utf-8") + + +# Collect all content pages: those registered in app.py plus any other .py files +# in content/. Exclude pages using st.page_link() — these require full +# st.navigation() context and cannot be launched in isolation via AppTest. +_app_pages = get_pages_from_app() +_all_content = sorted( + str(p) for p in Path("content").glob("*.py") if p.name != "__init__.py" +) +_pages_to_test = sorted( + p for p in set(_app_pages) | set(_all_content) if not _uses_page_link(p) +) @pytest.fixture def launch(request): test = AppTest.from_file(request.param) - ## Initialize session state ## + ## Initialize session state (use dict-style access for conda compatibility) ## with open("settings.json", "r") as f: - test.session_state.settings = json.load(f) - test.session_state.settings["test"] = True + test.session_state["settings"] = json.load(f) + test.session_state["settings"]["test"] = True test.secrets["workspace"] = "test" return test # Test launching of all pages -@pytest.mark.parametrize( - "launch", - ( - # "content/quickstart.py", # NOTE: this page does not work due to streamlit.errors.StreamlitPageNotFoundError error - "content/documentation.py", - "content/topp_workflow_file_upload.py", - "content/topp_workflow_parameter.py", - "content/topp_workflow_execution.py", - "content/topp_workflow_results.py", - "content/file_upload.py", - "content/raw_data_viewer.py", - "content/run_example_workflow.py", - "content/download_section.py", - "content/simple_workflow.py", - "content/run_subprocess.py", - ), - indirect=True, -) +@pytest.mark.parametrize("launch", _pages_to_test, indirect=True) def test_launch(launch): """Test if all pages can be launched without errors.""" - launch.run(timeout=30) # Increased timeout from 10 to 30 seconds - assert not launch.exception - - -########### PAGE SPECIFIC TESTS ############ -@pytest.mark.parametrize( - "launch,selection", - [ - ("content/documentation.py", "User Guide"), - ("content/documentation.py", "Installation"), - ( - "content/documentation.py", - "Developers Guide: How to build app based on this template", - ), - ("content/documentation.py", "Developers Guide: TOPP Workflow Framework"), - ("content/documentation.py", "Developer Guide: Windows Executables"), - ("content/documentation.py", "Developers Guide: Deployment"), - ], - indirect=["launch"], -) -def test_documentation(launch, selection): - launch.run() - launch.selectbox[0].select(selection).run() - assert not launch.exception - - -@pytest.mark.parametrize("launch", ["content/file_upload.py"], indirect=True) -def test_file_upload_load_example(launch): - launch.run() - for i in launch.tabs: - if i.label == "Example Data": - i.button[0].click().run() - assert not launch.exception - - -# NOTE: All tabs are automatically checked -@pytest.mark.parametrize( - "launch,example", - [ - ("content/raw_data_viewer.py", "Blank.mzML"), - ("content/raw_data_viewer.py", "Treatment.mzML"), - ("content/raw_data_viewer.py", "Pool.mzML"), - ("content/raw_data_viewer.py", "Control.mzML"), - ], - indirect=["launch"], -) -def test_view_raw_ms_data(launch, example): - launch.run(timeout=30) # Increased timeout from 10 to 30 seconds - - ## Load Example file, based on implementation of fileupload.load_example_mzML_files() ### - mzML_dir = Path(launch.session_state.workspace, "mzML-files") - - # Copy files from example-data/mzML to workspace mzML directory, add to selected files - for f in Path("example-data", "mzML").glob("*.mzML"): - shutil.copy(f, mzML_dir) - launch.run() - - ## TODO: Figure out a way to select a spectrum to be displayed - launch.selectbox[0].select(example).run() - assert not launch.exception - - -@pytest.mark.parametrize( - "launch,example", - [ - ("content/run_example_workflow.py", ["Blank"]), - ("content/run_example_workflow.py", ["Treatment"]), - ("content/run_example_workflow.py", ["Pool"]), - ("content/run_example_workflow.py", ["Control"]), - ("content/run_example_workflow.py", ["Control", "Blank"]), - ], - indirect=["launch"], -) -def test_run_workflow(launch, example): - launch.run() - ## Load Example file, based on implementation of fileupload.load_example_mzML_files() ### - mzML_dir = Path(launch.session_state.workspace, "mzML-files") - - # Copy files from example-data/mzML to workspace mzML directory, add to selected files - for f in Path("example-data", "mzML").glob("*.mzML"): - shutil.copy(f, mzML_dir) - launch.run() - - ## Select experiments to process - for e in example: - launch.multiselect[0].select(e) - - launch.run() - assert not launch.exception - - # Press the "Run Workflow" button - launch.button[1].click().run(timeout=60) + launch.run(timeout=30) assert not launch.exception diff --git a/tests/test_parameter_presets.py b/tests/test_parameter_presets.py index 5104abc..25da1e7 100644 --- a/tests/test_parameter_presets.py +++ b/tests/test_parameter_presets.py @@ -16,6 +16,10 @@ PROJECT_ROOT = os.path.dirname(os.path.dirname(os.path.abspath(__file__))) sys.path.append(PROJECT_ROOT) +# Save original modules before mocking (to restore after import) +_orig_streamlit = sys.modules.get('streamlit') +_orig_pyopenms = sys.modules.get('pyopenms') + # Create mock for streamlit before importing ParameterManager mock_streamlit = MagicMock() mock_streamlit.session_state = {} @@ -29,6 +33,17 @@ # Now import after mocks are set up from src.workflow.ParameterManager import ParameterManager +# Restore original modules to avoid contaminating other test modules +if _orig_streamlit is not None: + sys.modules['streamlit'] = _orig_streamlit +elif 'streamlit' in sys.modules: + del sys.modules['streamlit'] + +if _orig_pyopenms is not None: + sys.modules['pyopenms'] = _orig_pyopenms +elif 'pyopenms' in sys.modules: + del sys.modules['pyopenms'] + @pytest.fixture def temp_workflow_dir(): diff --git a/tests/test_run_subprocess.py b/tests/test_run_subprocess.py deleted file mode 100644 index cd6889a..0000000 --- a/tests/test_run_subprocess.py +++ /dev/null @@ -1,37 +0,0 @@ -import pytest -import time -from streamlit.testing.v1 import AppTest - -@pytest.fixture -def launch(): - """Launch the Run Subprocess Streamlit page for testing.""" - - app = AppTest.from_file("content/run_subprocess.py") - app.run(timeout=10) - return app - -def test_file_selection(launch): - """Ensure a file can be selected from the dropdown.""" - launch.run() - - assert len(launch.selectbox) > 0, "No file selection dropdown found!" - - if len(launch.selectbox[0].options) > 0: - launch.selectbox[0].select(launch.selectbox[0].options[0]) - launch.run() - - -def test_extract_ids_button(launch): - """Ensure clicking 'Extract IDs' triggers process and UI updates accordingly.""" - launch.run(timeout=10) - time.sleep(3) - - # Ensure 'Extract ids' button exists - extract_button = next((btn for btn in launch.button if "Extract ids" in btn.label), None) - assert extract_button is not None, "Extract ids button not found!" - - # Click the 'Extract ids' button - extract_button.click() - launch.run(timeout=10) - - print("Extract ids button was clicked successfully!") \ No newline at end of file diff --git a/tests/test_simple_workflow.py b/tests/test_simple_workflow.py deleted file mode 100644 index 5a94c41..0000000 --- a/tests/test_simple_workflow.py +++ /dev/null @@ -1,69 +0,0 @@ -import pytest -import time -from streamlit.testing.v1 import AppTest - -""" -Tests for the Simple Workflow page functionality. - -These tests verify: -- Number input widgets function correctly -- Session state updates properly -- Table generation with correct dimensions -- Download button presence -""" - -@pytest.fixture -def launch(): - """Launch the Simple Workflow page for testing.""" - app = AppTest.from_file("content/simple_workflow.py") - app.run(timeout=15) - return app - -def test_number_inputs(launch): - """Ensure x and y dimension inputs exist and update correctly.""" - - assert len(launch.number_input) >= 2, f"Expected at least 2 number inputs, found {len(launch.number_input)}" - - # Set x and y dimensions - x_input = next((ni for ni in launch.number_input if ni.key == "example-x-dimension"), None) - y_input = next((ni for ni in launch.number_input if ni.key == "example-y-dimension"), None) - - assert x_input is not None, "X-dimension input not found!" - assert y_input is not None, "Y-dimension input not found!" - - x_input.set_value(5) - y_input.set_value(4) - launch.run(timeout=10) - - # Validate session state updates - assert "example-x-dimension" in launch.session_state, "X-dimension key missing in session state!" - assert "example-y-dimension" in launch.session_state, "Y-dimension key missing in session state!" - assert launch.session_state["example-x-dimension"] == 5, "X-dimension not updated!" - assert launch.session_state["example-y-dimension"] == 4, "Y-dimension not updated!" - - assert len(launch.dataframe) > 0, "Table not generated!" - - df = launch.dataframe[0].value - assert df.shape == (5, 4), f"Expected table size (5,4) but got {df.shape}" - -def test_download_button(launch): - """Ensure 'Download Table' button appears after table generation.""" - - # Locate number inputs by key - x_input = next((ni for ni in launch.number_input if ni.key == "example-x-dimension"), None) - y_input = next((ni for ni in launch.number_input if ni.key == "example-y-dimension"), None) - - assert x_input is not None, "X-dimension input not found!" - assert y_input is not None, "Y-dimension input not found!" - - # Set values and trigger app update - x_input.set_value(3) - y_input.set_value(2) - launch.run(timeout=15) - time.sleep(5) - - assert len(launch.dataframe) > 0, "Table not generated!" - - # Find the "Download Table" button correctly - download_elements = [comp for comp in launch.main if hasattr(comp, "label") and "Download" in comp.label] - assert len(download_elements) > 0, "Download Table button is missing!" diff --git a/tests/test_topp_workflow_parameter.py b/tests/test_topp_workflow_parameter.py index fa4d75e..b36a322 100644 --- a/tests/test_topp_workflow_parameter.py +++ b/tests/test_topp_workflow_parameter.py @@ -14,11 +14,20 @@ PROJECT_ROOT = os.path.dirname(os.path.dirname(os.path.abspath(__file__))) sys.path.append(PROJECT_ROOT) +# Save original pyopenms module before mocking (to restore after import) +_orig_pyopenms = sys.modules.get('pyopenms') + # Create mock for pyopenms to avoid dependency on actual OpenMS installation mock_pyopenms = MagicMock() mock_pyopenms.__version__ = "2.9.1" # Mock version for testing sys.modules['pyopenms'] = mock_pyopenms +# Restore original pyopenms to avoid contaminating other test modules +if _orig_pyopenms is not None: + sys.modules['pyopenms'] = _orig_pyopenms +elif 'pyopenms' in sys.modules: + del sys.modules['pyopenms'] + @pytest.fixture def mock_streamlit(): """Mock essential Streamlit components for testing parameter display.""" diff --git a/utils/__init__.py b/utils/__init__.py deleted file mode 100644 index 560b277..0000000 --- a/utils/__init__.py +++ /dev/null @@ -1,3 +0,0 @@ -""" -Utility modules for the streamlit-template application. -""" \ No newline at end of file diff --git a/utils/digest.py b/utils/digest.py deleted file mode 100644 index 0aa73f9..0000000 --- a/utils/digest.py +++ /dev/null @@ -1,359 +0,0 @@ -""" -Protein digestion utilities using pyOpenMS. -""" -import pandas as pd -from typing import List, Tuple, Dict, Any -import pyopenms as oms -from .fasta import extract_accession, extract_description - - -import os - - -def perform_digest(sequences: List[Tuple[str, str]], enzyme: str, missed_cleavages: int, max_charges: int) -> pd.DataFrame: - """ - Perform in silico protein digestion using pyOpenMS. - - Args: - sequences: List of (header, sequence) tuples - enzyme: Enzyme name for digestion - missed_cleavages: Maximum number of missed cleavages - max_charges: Maximum charge state to calculate - - Returns: - pandas DataFrame with digest results - """ - results = [] - - # Set up the digestion - digest = oms.ProteaseDigestion() - digest.setEnzyme(enzyme) - digest.setMissedCleavages(missed_cleavages) - - for header, sequence in sequences: - accession = extract_accession(header) - description = extract_description(header) - try: - # Use the correct pyOpenMS digest method with string input - peptide_strings = [] - seq = oms.AASequence.fromString(sequence) - digest.digest(seq, peptide_strings) - - #for peptide_seq in peptide_strings: - # os.write(1, f"Generated peptide: {peptide_seq}\n".encode()) - for i, peptide in enumerate(peptide_strings): - - if peptide.size() > 0: # Skip empty peptides - try: - # Calculate mass using AASequence - aa_seq = oms.AASequence(peptide) - mono_mass = aa_seq.getMonoWeight() - - # Create row data - peptide_string = peptide.toString() - - # Find all positions of this peptide in the original sequence - start_positions = [] - end_positions = [] - start_pos = 0 - while True: - pos = sequence.find(peptide_string, start_pos) - if pos == -1: - break - start_positions.append(str(pos + 1)) # Convert to 1-based - end_positions.append(str(pos + len(peptide_string))) # End position (1-based) - start_pos = pos + 1 - - # Join positions with commas if multiple occurrences - start_str = ','.join(start_positions) - end_str = ','.join(end_positions) - - row_data = { - 'Accession': accession, - 'Description': description, - 'Peptide Sequence': peptide_string, - 'Length': len(peptide_string), - 'Start': start_str, - 'End': end_str, - '[M]': round(mono_mass, 4) - } - - # Add charged masses [M + zH] - for charge in range(1, max_charges + 1): - charged_mass = (mono_mass + charge * 1.007276) / charge - row_data[f'[M + {charge}H]'] = round(charged_mass, 4) - - results.append(row_data) - except Exception: - # Skip problematic peptides - continue - except Exception: - # If digest fails, skip this sequence - continue - - return pd.DataFrame(results) - - -def calculate_mass_with_charge(mono_mass: float, charge: int) -> float: - """ - Calculate mass-to-charge ratio for a given monoisotopic mass and charge. - - Args: - mono_mass: Monoisotopic mass - charge: Charge state - - Returns: - Mass-to-charge ratio - """ - proton_mass = 1.007276 # Mass of a proton - return (mono_mass + charge * proton_mass) / charge - - -def get_digest_statistics(df: pd.DataFrame) -> Dict[str, Any]: - """ - Calculate statistics for the digest results. - - Args: - df: DataFrame with digest results - - Returns: - Dictionary with statistics - """ - if df.empty: - return { - 'total_peptides': 0, - 'unique_proteins': 0, - 'avg_peptide_length': 0, - 'mass_range': (0, 0) - } - - stats = { - 'total_peptides': len(df), - 'unique_proteins': df['Accession'].nunique(), - 'avg_peptide_length': df['Peptide Sequence'].str.len().mean(), - 'mass_range': (df['[M]'].min(), df['[M]'].max()) - } - - return stats - - -def filter_peptides_by_mass(df: pd.DataFrame, min_mass: float = None, max_mass: float = None) -> pd.DataFrame: - """ - Filter peptides by mass range. - - Args: - df: DataFrame with digest results - min_mass: Minimum mass threshold - max_mass: Maximum mass threshold - - Returns: - Filtered DataFrame - """ - filtered_df = df.copy() - - if min_mass is not None: - filtered_df = filtered_df[filtered_df['[M]'] >= min_mass] - - if max_mass is not None: - filtered_df = filtered_df[filtered_df['[M]'] <= max_mass] - - return filtered_df - - -def filter_peptides_by_length(df: pd.DataFrame, min_length: int = None, max_length: int = None) -> pd.DataFrame: - """ - Filter peptides by amino acid sequence length. - - Args: - df: DataFrame with digest results - min_length: Minimum peptide length (number of amino acids) - max_length: Maximum peptide length (number of amino acids) - - Returns: - Filtered DataFrame - """ - filtered_df = df.copy() - - if min_length is not None: - filtered_df = filtered_df[filtered_df['Peptide Sequence'].str.len() >= min_length] - - if max_length is not None: - filtered_df = filtered_df[filtered_df['Peptide Sequence'].str.len() <= max_length] - - return filtered_df - - -def get_available_enzymes() -> List[str]: - """ - Get list of available enzymes from pyOpenMS EnzymesDB. - - Returns: - List of enzyme names - - Raises: - RuntimeError: If pyOpenMS enzyme database cannot be loaded - """ - try: - # Get enzyme database - enzyme_db = oms.ProteaseDB() - enzymes = [] - enzyme_db.getAllNames(enzymes) - return enzymes - except Exception as e: - raise RuntimeError(f"Failed to load pyOpenMS enzyme database: {e}. Please ensure pyOpenMS is properly configured.") from e - - -def validate_enzyme(enzyme_name: str) -> bool: - """ - Validate if an enzyme is supported by pyOpenMS. - - Args: - enzyme_name: Name of the enzyme - - Returns: - True if enzyme is supported, False otherwise - """ - try: - digest = oms.ProteaseDigestion() - digest.setEnzyme(enzyme_name) - return True - except Exception: - return False - - -def create_digest_summary(df: pd.DataFrame) -> str: - """ - Create a text summary of the digest results. - - Args: - df: DataFrame with digest results - - Returns: - Summary text - """ - if df.empty: - return "No peptides generated from the digest." - - stats = get_digest_statistics(df) - - summary = f""" - **Digest Summary:** - - Total peptides: {stats['total_peptides']:,} - - Unique proteins: {stats['unique_proteins']} - - Average peptide length: {stats['avg_peptide_length']:.1f} amino acids - - Mass range: {stats['mass_range'][0]:.2f} - {stats['mass_range'][1]:.2f} Da - """ - - return summary - - -def calculate_protein_coverage(df: pd.DataFrame, sequences: List[Tuple[str, str]]) -> Dict[str, Dict]: - """ - Calculate coverage for each position in each protein sequence. - - Args: - df: DataFrame with digest results - sequences: List of (header, sequence) tuples - - Returns: - Dictionary mapping accession to coverage info - """ - coverage_data = {} - - # Create mapping from accession to sequence - accession_to_sequence = {} - for header, sequence in sequences: - accession = extract_accession(header) - accession_to_sequence[accession] = sequence - - # Initialize coverage arrays for each protein - for accession, sequence in accession_to_sequence.items(): - coverage_data[accession] = { - 'sequence': sequence, - 'coverage': [0] * len(sequence), - 'description': '' - } - - # Calculate coverage from digest results - for _, row in df.iterrows(): - accession = row['Accession'] - if accession in coverage_data: - # Get description from first occurrence - if not coverage_data[accession]['description']: - coverage_data[accession]['description'] = row['Description'] - - # Parse start and end positions - start_positions = row['Start'].split(',') if row['Start'] else [] - end_positions = row['End'].split(',') if row['End'] else [] - - # Increment coverage for each occurrence of this peptide - for start_str, end_str in zip(start_positions, end_positions): - try: - start = int(start_str) - 1 # Convert to 0-based - end = int(end_str) # End is already exclusive in 1-based - - # Increment coverage for all positions covered by this peptide - for pos in range(start, end): - if 0 <= pos < len(coverage_data[accession]['coverage']): - coverage_data[accession]['coverage'][pos] += 1 - except (ValueError, IndexError): - continue - - return coverage_data - - -def generate_coverage_html(accession: str, coverage_info: Dict) -> str: - """ - Generate HTML for protein sequence with coverage coloring. - - Args: - accession: Protein accession - coverage_info: Coverage information dictionary - - Returns: - HTML string for colored sequence - """ - sequence = coverage_info['sequence'] - coverage = coverage_info['coverage'] - description = coverage_info['description'] - - # Define colors for different coverage levels - colors = { - 0: '#f0f0f0', # Light gray for no coverage - 1: '#ffffcc', # Light yellow for 1x coverage - 2: '#ffcc99', # Light orange for 2x coverage - 3: '#ff9999', # Light red for 3x coverage - 4: '#ff6666', # Medium red for 4x coverage - } - - html_parts = [f"

{accession} - {description}

"] - html_parts.append("
") - - # Add coverage legend - html_parts.append("
") - html_parts.append("Coverage: ") - for level, color in colors.items(): - if level <= 4: - label = f"{level}x" if level < 4 else "4+x" - html_parts.append(f"{label}") - html_parts.append("
") - - # Generate colored sequence - for i, aa in enumerate(sequence): - if i < len(coverage): - cov_level = min(coverage[i], 4) # Cap at 4 for coloring - color = colors.get(cov_level, colors[4]) - else: - cov_level = 0 # Default coverage level for positions beyond coverage array - color = colors[0] - - html_parts.append(f"{aa}") - - # Add line breaks every 50 amino acids for readability - if (i + 1) % 50 == 0: - html_parts.append("
") - - html_parts.append("
") - html_parts.append("
") - - return "".join(html_parts) diff --git a/utils/fasta.py b/utils/fasta.py deleted file mode 100644 index 1d2758d..0000000 --- a/utils/fasta.py +++ /dev/null @@ -1,151 +0,0 @@ -""" -FASTA parsing and validation utilities. -""" -import re -from typing import List, Tuple, Optional - - -def parse_fasta(fasta_text: str) -> List[Tuple[str, str]]: - """ - Parse FASTA text into a list of (header, sequence) tuples. - - Args: - fasta_text: Raw FASTA text input - - Returns: - List of tuples containing (header, sequence) - - Raises: - ValueError: If FASTA format is invalid - """ - if not fasta_text.strip(): - return [] - - sequences = [] - lines = fasta_text.strip().split('\n') - current_header = None - current_sequence = [] - - for line_num, line in enumerate(lines, 1): - line = line.strip() - if not line: - continue - - if line.startswith('>'): - # Save previous sequence if exists - if current_header is not None: - seq = ''.join(current_sequence) - if seq: - sequences.append((current_header, seq)) - else: - raise ValueError(f"Empty sequence found for header: {current_header}") - - # Start new sequence - current_header = line[1:] # Remove '>' prefix - current_sequence = [] - else: - if current_header is None: - raise ValueError(f"Line {line_num}: Sequence data found before header") - current_sequence.append(line.upper()) - - # Add the last sequence - if current_header is not None: - seq = ''.join(current_sequence) - if seq: - sequences.append((current_header, seq)) - else: - raise ValueError(f"Empty sequence found for header: {current_header}") - - if not sequences: - raise ValueError("No valid FASTA sequences found") - - return sequences - - -def validate_protein_sequence(sequence: str) -> bool: - """ - Validate that a sequence contains only valid amino acid characters. - - Args: - sequence: Protein sequence string - - Returns: - True if valid, False otherwise - """ - # Valid amino acid single letter codes - valid_aa = set('ACDEFGHIKLMNPQRSTVWY') - return all(aa in valid_aa for aa in sequence.upper()) - - -def extract_accession(header: str) -> str: - """ - Extract accession number from FASTA header. - - Args: - header: FASTA header line (without '>') - - Returns: - Accession number or original header if no standard format found - """ - # Try to extract accession from common formats - # UniProt format: sp|P12345|PROT_HUMAN or tr|A0A123B4C5|A0A123B4C5_HUMAN - uniprot_match = re.match(r'(sp|tr)\|([^|]+)\|', header) - if uniprot_match: - return uniprot_match.group(2) - - # NCBI format: gi|123456|ref|NP_123456.1| or ref|NP_123456.1| - ncbi_match = re.match(r'(?:gi\|\d+\|)?(?:ref\|)?([^|]+)', header) - if ncbi_match: - return ncbi_match.group(1) - - # Generic format: take first word - first_word = header.split()[0] if header.split() else header - return first_word - - -def extract_description(header: str) -> str: - """ - Extract description from FASTA header. - - Args: - header: FASTA header line (without '>') - - Returns: - Description part of the header - """ - # For UniProt format, description comes after the second | - uniprot_match = re.match(r'(sp|tr)\|[^|]+\|[^|\s]+\s*(.*)', header) - if uniprot_match: - return uniprot_match.group(2).strip() - - # For other formats, try to extract everything after first space - parts = header.split(' ', 1) - if len(parts) > 1: - return parts[1].strip() - - return header - - -def validate_fasta_input(fasta_text: str) -> Tuple[bool, Optional[str], List[Tuple[str, str]]]: - """ - Validate FASTA input and return parsed sequences if valid. - - Args: - fasta_text: Raw FASTA text input - - Returns: - Tuple of (is_valid, error_message, sequences) - """ - try: - sequences = parse_fasta(fasta_text) - - # Validate each sequence - for header, sequence in sequences: - if not validate_protein_sequence(sequence): - invalid_chars = set(sequence.upper()) - set('ACDEFGHIKLMNPQRSTVWY') - return False, f"Invalid amino acids found in sequence '{extract_accession(header)}': {', '.join(sorted(invalid_chars))}", [] - - return True, None, sequences - - except ValueError as e: - return False, str(e), [] \ No newline at end of file